MGF и PEG-MGF: Механический Фактор Роста и его биоактивность

Матрикины Pal-GHK, Pal-GQPR и Pal-KTTKS
04.07.2019
Артериальное давление и лактотрипептиды
23.08.2019

 

Механический фактор роста (MGF, Mechano-growth factor, insulin-like growth factor-1Ec, IGF-1Eс) является изоформой белка семейства инсулиноподобных факторов роста IGF-1, строение и действие которых сходны с инсулином. Такие пептиды задействованы в регуляции процессов роста, развития и дифференцировки клеток и тканей организма. При физических упражнениях и локальных мышечных повреждениях MGF способствует активированию и восполнению пула мышечных стволовых клеток-сателлитов, тем самым способствуя восстановлению и развитию поврежденных мышечных волокон.

MGF обладает следующей аминокислотной последовательностью:

YQPPSTNKNTKSQRRKGSTFEERK-NH2 – мол. масса 2865.5 Da

Однако, известно, что под названием MGF принимают и «полноразмерный» (“full length”) MGF с удлинённой аминокислотной последовательностью:

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEH
– мол. масса 12264.9 Da

MGF образуется в результате альтернативного сплайсинга шести экзонов гена Igf1 [1-3]. В MGF альтернативный сплайсинг приводит к изменению порядка считывания кода и, следовательно, специфической C-концевой последовательности (т.н. E-домену, стабильному элементу третичной структуры пептида из 24 аминокислот), кодируемой экзоном 5 и первой частью экзона 6. Предполагается, что E-домены могут функционировать как независимые биологически активные пептиды. Действительно, показано, что терминальный пептид MGF может действовать на мышечные клетки независимо от остальной молекулы [4]. Пептид MGF не имеет гликозилированных сайтов в E-домене, как в случае IGF-1Ea. Это может объяснять более низкую стабильности MGF в клетках. Также показано, что MGF не связывается с белком, связывающим IGF-1, что делает его более уязвимым к деградации протеазами во внеклеточном пространстве [5]. Интересно, что пептиды IGF-1 и MGF могут вызывать разные эффекты: MGF способствует пролиферации (разрастанию ткани путём деления клеток) стволовых клеток, дифференцировка которых уже определена (сателлитных клеток), тогда как IGF-1 индуцирует дифференцировку. Изоформу IGF-1Eс обозначают как механический фактор роста, MGF, поскольку кодирующая его РНК образуется в мышцах в ответ на перегрузку и повреждение, что подтверждено испытаниями in vitro (см. ниже).

Белки семейства IGF вырабатывается преимущественно печенью. Их синтез стимулируется гормоном роста (GH), который вырабатывается в передней части гипофиза, выделяется в кровоток, а затем стимулирует печень к выработке IGF [4]. Затем IGF-1 стимулирует системный рост организма и почти всех клеток организма, особенно скелетных мышц, хрящей, костей, печени, почек, нервов, кожи, кроветворных клеток и клеток легких. В дополнение к инсулиноподобным эффектам, IGF-1 может также регулировать синтез клеточной ДНК [6]. IGF-1 связывается по крайней мере с двумя рецепторными тирозинкиназами на поверхности клетки: рецептором IGF-1 (IGF1R) и рецептором инсулина. Его первичное действие опосредуется связыванием с его специфическим рецептором, IGF1R, который присутствует на поверхности многих типов клеток во многих тканях. Связывание с IGF1R инициирует внутриклеточную передачу сигналов. IGF-1 является одним из наиболее мощных природных активаторов сигнального пути AKT, стимулятором роста и пролиферации клеток и мощным ингибитором запрограммированной гибели клеток – апоптоза [7, 8].

Изучение синтеза пептида (экспрессии) MGF в исследовании на остеобластах, являющихся молодыми клетками костной ткани, при статичном культивировании (контроль) и циклическом растяжении, показало, что остеобласты в статичной культуре проявляли слабую экспрессию MGF. Напротив, циклическое растяжение увеличивало экспрессию белка MGF. В трех временных точках (6, 12 и 24 ч) уровень MGF был в 2,7, 5,2 и 1,1 раза выше, чем в контрольной группе. Самый высокий уровень наблюдался через 12 часов, что отсрочено во времени по сравнению с пиковым уровнем мРНК MGF через 6 часов [5].

В модели in vivo обнаружено, что введение MGF увеличивает локальный рост мышц у мышей (введение вектора кДНК) [9], но на человеке таких исследований не проводилось. Вариант гена Igf-1, кодирующего MGF, активируется в скелетных мышцах после тренировки с отягощениями и, по-видимому, способствует раннему восстановлению в ответ на вызванное нагрузкой повреждение мышц, а также блокировки апоптоза (клеточной гибели) поврежденных миоцитов (мышечных клеток) [10]. Было показано, что MGF усиливает активацию, пролиферацию и слияние сателлитных клеток, а также гипертрофию в мышцах человека in vitro [11]. При этом, наблюдается ингибирование дифференцировки миобластов (клеток-предшественников миоцитов) и практически не наблюдается влияния на первичные мышечные стволовые клетки [1]. E-домен MGF вызывает повышенную миграцию мезенхимальных стволовых клеток человека (hMSC) и клеток-предшественников миогена человека при доставке микрокапсул гидрогеля поли(этиленгликоль)диметакрилата (PEGDMA), загруженных пептидом, также был обнаружен эффект защиты от апоптоза [12]. Уникальная область E-домена MGF человека (IGF-1Ec) улучшает сердечную функцию после инфаркта миокарда, что было выявлено в экспериментах in vivo по введению MGF-содержащих полимерных микроструктур посредством внутримышечной инъекции после лигирования коронарной артерии у мышей [13].

Неспособность вырабатывать MGF может лежать в основе возрастной потери функции скелетных мышц [4]. Блокирование рецептора IGF-I специфическими антителами указывает на то, что функция E-домена MGF опосредуется через другой рецептор. Это объясняет, почему потеря массы происходит в состаренной и дистрофический мышечной ткани [14].

 

PEG-MGF является MGF, в который по N-концам лизина введен один или несколько фрагментов полиэтиленгликоля массой до 45 kDa [15]. PEG-MGF обладает большим периодом полураспада, что позволяет значительно снизить дозу и частоту приема препарата. Средняя молекулярная масса дериватизированного пептида зависит от размера присоединенного остатка PEG, количества и разветвленности таких фрагментов [16]. В продаже, для применения спортсменами, часто встречается PEG-MGF с массой фрагмента PEG в диапазоне 1,8–2 kDa. Форма PEG-MGF является более стабильной и имеет гораздо более длительный период полураспада, поскольку PEG повышает молекулярную стабильность. Кроме того, введение PEG повышает гидрофильность молекулы, тем самым повышая биодоступность MGF. [17]. Стабильность пептида может быть оценена как период полураспада в плазме человека путем измерения устойчивости пептидов к протеолитическому расщеплению в свежей плазме с детекцией методом вестерн-блоттинга. Так, в эксперименте после инкубации в плазме, относительно небольшое количество неизмененного MGF детектировано через 30 минут (~35 %), очень мало – через 2 часа (~5 %) , полная деградация MGF наступает через 24 часа. Напротив, в случае модифицированного пептида с D-Arg в 14 и 15 положениях (другой широко применяемый вариант стабилизации MGF) или PEG-MGF, пептиды обнаруживались в гораздо большем количестве через 2 и даже 24 часа (~70 % от исходного значения) [18]. Таким образом, время полураспада для MGF составляет 20 минут, тогда как производные MGF на два порядка более стабильны.

Медицинских клинических исследований на человеке PEG-MGF не проводилось, но полагают, что его активность близка к PEG-IGF1. Известно, что PEG-IGF1 более эффективен при восстановлении мышц по сравнению с IGF-1 [19], поэтому можно предположить, что PEG-MGF сохраняет не меньшую активность, чем MGF, и даже, с учетом более длительного периода полураспада, превосходит ее, что позволяет существенно снизить дозу и частоту введения препарата (до 2–3 раз в неделю). Единственное предположение в отношении влияния пегилирования, локализованного в D-домене заключается в том, что фрагмент PEG может стерически препятствовать взаимодействию со связывающим белком IGFBP [1].

 

Пептидные гормоны, отнесенные к категории факторов механического роста (MGF), были явно упомянуты как запрещенные вещества в соответствующих нормативных актах Всемирного антидопингового агентства (WADA) с 2005 года. Результаты исследования образцов MGF, полученных с «черного рынка», были опубликованы в 2012 году, подчеркивают потенциальное злоупотребление такими соединениями в любительском и/или профессиональном спорте, особенно тяжелой атлетике и бодибилдинге, несмотря на клинически неподтвержденную эффективность. Показано, что продукт с «черного рынка» состоит из соответствующих 24 аминокислотных остатков, но включает С-концевое амидирование, которое не было постулировано для встречающегося в природе MGF человека [20]. Интернет-магазинами предоставляется и «полноразмерный» MGF.

MGF доступен в виде жидкости для инъекций или порошка для растворения перед инъекцией. Однако происхождение и безопасность таких продуктов может быть подтверждено только путем комплексного анализа, который не является доступным для потребителей. Эти продукты рассматриваются как контрафактные. Долгое время MGF считался необнаружимым допинг-тестами, однако в 2014 году с использованием масс-спектрометрии была показана возможность выявления его употребления спортсменами в допинг-контроле [20, 21]. Стоит отметить, что неизоформный IGF-I также пользуется популярностью у спортсменов, особенно тяжелоатлетов, в качестве допинга [22].

В Интернете, и в блогах, посвященных бодибилдингу, можно видеть описания субъективных положительных эффектов, однако на момент 2019 года нет исследований, однозначно доказывающих влияние введения MGF на результаты тренировок с отягощениями у здоровых взрослых [23].

Дозировки MGF и PEG-MGF официально не установлены. Различные источники сообщают об использовании IGF-1EC, который вводят инъекционно после тренировки в тренируемые мышцы. Обычные дозы составляют 50, 100 или 200 μг после каждой тренировки, 2-3 раза в неделю (Неподтвержденные данные из сети Интернет, неизвестен состав и аутентичность препаратов!). Интернет-магазины, как правило, поставляют продукт в фасовке по 2 и 5 мг. Препараты, получаемые от нерегулируемых продавцов, несут риски по чистоте, качеству и аутентичности заявленного вещества. Например, обнаружено, что подавляющая часть таких препаратов имеет низкую степень очистки, содержат биологически активные примеси неизвестной природы (предположительно – побочные продукты синтеза или разрушения пептида при длительном хранении в ненадлежащих условиях). Выявлено часто встречающееся несоответствие содержимого тары заявленной маркировке – ряд препаратов, включая MGF и PEG-MGF, содержат совершенно другое активное вещество или вовсе не содержат активных веществ («пустышки») [24].

Несмотря на обилие разрозненной и не всегда согласованной информации относительно биоактивности MGF и PEG-MGF, результаты испытаний на моделях in vivo и in vitro однозначно показывают, что данные пептиды имеют нераскрытый потенциал для дальнейших исследований и практического применения, а их низкая токсичность и предсказуемая активность открывает путь к клиническим испытаниям на человеке.

 

Список литературы

  1. Vassilakos, G., Barton, E.R., Insulin-Like Growth Factor I Regulation and Its Actions in Skeletal Muscle. Comprehensive Physiology, 2019. 9: p. 413-438. DOI: 10.1002/cphy.c180010.
  2. Альтернативный сплайсинг: https://ru.wikipedia.org/wiki/%D0%90%D0%BB%D1%8C%D1%82%D0%B5%D1%80%D0%BD%D0%B0%D1%82%D0%B8%D0%B2%D0%BD%D1%8B%D0%B9_%D1%81%D0%BF%D0%BB%D0%B0%D0%B9%D1%81%D0%B8%D0%BD%D0%B3
  3. Экзон: https://ru.wikipedia.org/wiki/%D0%AD%D0%BA%D0%B7%D0%BE%D0%BD
  4. Dłużniewska, J., Sarnowska, A., Beręsewicz, M., Johnson, I., Srai, S.K., Ramesh, B., Goldspink, G., Górecki, D.C., Zabłocka, B., A strong neuroprotective effect of the autonomous C-terminal peptide of IGF-1 Ec (MGF) in brain ischemia. The FASEB journal, 2005. 19(13): p. 1896-1898. DOI: 10.1096/fj.05-3786fje.
  5. Zhang, B., Xian, C., Luo, Y., Wang, Y., Expression and subcellular localization of mechano-growth factor in osteoblasts under mechanical stretch. Science in China Series C: Life Sciences, 2009. 52(10): p. 928-934. DOI: 10.1007/s11427-009-0122-4.
  6. Yakar, S., Rosen, C.J., Beamer, W.G., Ackert-Bicknell, C.L., Wu, Y., Liu, J.-L., Ooi, G.T., Setser, J., Frystyk, J., Boisclair, Y.R., LeRoith, D., Circulating levels of IGF-1 directly regulate bone growth and density. The Journal of Clinical Investigation, 2002. 110(6): p. 771-781. DOI: 10.1172/JCI15463.
  7. Peruzzi, F., Prisco, M., Dews, M., Salomoni, P., Grassilli, E., Romano, G., Calabretta, B., Baserga, R., Multiple Signaling Pathways of the Insulin-Like Growth Factor 1 Receptor in Protection from Apoptosis. Molecular and Cellular Biology, 1999. 19(10): p. 7203. DOI: 10.1128/MCB.19.10.7203.
  8. Juin, P., Hueber, A.-O., Littlewood, T., Evan, G., c-Myc-induced sensitization to apoptosis is mediated through cytochrome c release. Genes & Development, 1999. 13(11): p. 1367-1381. DOI: 10.1101/gad.13.11.1367.
  9. Goldspink, G., Research on mechano growth factor: its potential for optimising physical training as well as misuse in doping. British journal of sports medicine, 2005. 39(11): p. 787-788. DOI: 10.1136/bjsm.2004.015826.
  10. Ates, K., Yang, S.Y., Orrell, R.W., Sinanan, A.C.M., Simons, P., Solomon, A., Beech, S., Goldspink, G., Lewis, M.P., The IGFI splice variant MGF increases progenitor cells in ALS, dystrophic, and normal muscle. FEBS letters, 2007. 581(14): p. 2727-2732. DOI: 10.1016/j.febslet.2007.05.030.
  11. Kandalla, P.K., Goldspink, G., Butler-Browne, G., Mouly, V., Mechano Growth Factor E peptide (MGF-E), derived from an isoform of IGF-1, activates human muscle progenitor cells and induces an increase in their fusion potential at different ages. Mechanisms of ageing development, 2011. 132(4): p. 154-162. DOI: 10.1016/j.mad.2011.02.007.
  12. Doroudian, G., Pinney, J., Ayala, P., Los, T., Desai, T.A., Russell, B., Sustained delivery of MGF peptide from microrods attracts stem cells and reduces apoptosis of myocytes. Biomed Microdevices, 2014. 16(5): p. 705-715. DOI: 10.1007/s10544-014-9875-z.
  13. Peña, J.R., Pinney, J.R., Ayala, P., Desai, T.A., Goldspink, P.H., Localized delivery of mechano-growth factor E-domain peptide via polymeric microstructures improves cardiac function following myocardial infarction. Biomaterials, 2015. 46: p. 26-34. DOI: 10.1016/j.biomaterials.2014.12.050.
  14. Yang, S.Y., Goldspink, G., Different roles of the IGFI Ec peptide (MGF) and mature IGFI in myoblast proliferation and differentiation. FEBS letters, 2002. 522(1-3): p. 156-160. DOI: 10.1016/S0014-5793(02)02918-6.
  15. Method for the production of conjugates of insulin-like growth factor-1 and poly (ethylene glycol). US20100210547, Fischer, S., Hesse, F., Knoetgen, H., Lang, K., Metzger, F., Regula, J.T., Schantz, C., Schaubmar, A., Schoenfeld, H.-J. Available from: https://patents.google.com/patent/US20100210547A1/.
  16. Подробнее о доступных и применяемых PEG-фрагментах см. https://www.thermofisher.com/ru/ru/home/life-science/protein-biology/protein-biology-learning-center/protein-biology-resource-library/pierce-protein-methods/polyethylene-glycol-peg-pegylation-proteins.html
  17. Veronese, F.M., Mero, A., The impact of PEGylation on biological therapies. BioDrugs, 2008. 22(5): p. 315-329. DOI: 10.2165/00063030-200822050-00004.
  18. Mecano growth factor peptides and their use. WO2006097764, Goldspink, G., Yang, S.Y., Goldspink, P. Available from: https://patents.google.com/patent/WO2006097764.
  19. Martins, K.J.B., Gehrig, S.M., Naim, T., Saenger, S., Baum, D., Metzger, F., Lynch, G.S., Intramuscular administration of PEGylated IGF-I improves skeletal muscle regeneration after myotoxic injury. Growth Hormone & IGF Research, 2013. 23(4): p. 128-133. DOI: 10.1016/j.ghir.2013.03.002.
  20. Thevis, M., Schänzer, W., Analytical approaches for the detection of emerging therapeutics and non-approved drugs in human doping controls. Journal of Pharmaceutical and Biomedical Analysis, 2014. 101: p. 66-83. DOI: 10.1016/j.jpba.2014.05.020.
  21. Esposito, S., Doping control analysis of small peptide hormones. 2015, Ghent University.
  22. Brennan, B.P., Kanayama, G., Hudson, J.I., Pope, J., Harrison G, Human growth hormone abuse in male weightlifters. The American journal on addictions, 2011. 20(1): p. 9-13. DOI: 10.1111/j.1521-0391.2010.00093.x.
  23. Guimarães-Ferreira, L., Cholewa, J.M., Dantas, W.S., Murai, I., Duncan, M.J., Zanchi, N.E., Chapter 3 – Performance-Enhancing Drugs and Sports Supplements for Resistance Training, in Nutrition and Enhanced Sports Performance (Second Edition), D. Bagchi, Nair, S., Sen, C.K., Editors. 2019, Academic Press. p. 31-47.
  24. Зверева, И., Семенистая, Е., Кротов, Г., Родченков, Г., Идентификация допинговых соединений пептидной природы, распространяемых через интернет. Аналитика, 2014(3): p. 58-70.