Сенолитик FOXO4-DRI – избирательное разрушение стареющих клеток на пути к продлению жизни

Терипаратид и костная регенерация в ротовой полости
17.04.2020
Spadin, РЕ 22-28 и аналоги. Новая концепция антидепрессантов
04.05.2020

Старение – это прогрессирующая потеря функции тканями и органами с течением времени. Антагонистическая теория плейотропии (влияние единичного гена на несколько фенотипических признаков) предполагает, что приспособленность организма снижается, по крайней мере частично, потому что естественный отбор благоприятствует генетическим программам, которые оказывают положительное влияние на репродуктивную физическую форму в раннем возрасте, без учета негативного воздействия на здоровье после репродуктивного возраста [1]. Одним из наборов генов, которые, вероятно, можно квалифицировать как антагонистически плейотропные, являются регуляторы клеточного старения, мощный противоопухолевый механизм, который предотвращает злокачественные новообразования путем перманентного удаления (пре)опухолевых клеток из клеточного цикла, но также является движущей силой старения и возрастных заболеваний. Старение имеет два аспекта. Во-первых, оно вызывает потерю способности к восстановлению тканей из-за остановки клеточного цикла в клетках-предшественниках. Во-вторых, стареющие клетки продуцируют провоспалительные и разрушающие матрикс факторы в т. н. старческом секреторном фенотипе (SASP, Senescence-Associated Secretory Phenotype). Одной из причин того, что клеточное старение могло развиваться как противораковый механизм, наряду с запрограммированной гибелью клеток, является то, что стареющие клетки могут быть «вычищены» иммунными клетками, которые рекрутируются из-за провоспалительных факторов, секретируемых как часть SASP. В последнее время данные указывают на положительные эффекты клеточного старения, например, в регенерации ран и в эмбриогенезе. В этих условиях старение выполняет ремоделирующую роль по отношению к ткани, а стареющие клетки имеют относительно короткий период полураспада, потому что они эффективно вычищаются иммунными клетками. Напротив, старые клетки, которые хронически накапливают повреждения, в конечном итоге, достигают порога клеточного стресса, который вызывает их выход из клеточного цикла [1].

Устранение стареющих клеток и ослабление SASP выглядят привлекательными терапевтическими стратегиями; однако в настоящее время перенос этих результатов на применение в терапии человека ограничена фрагментарным пониманием как базовой молекулярной биологии стареющих клеток in vivo, так и старения как причины возрастных заболеваний в целом.

Открытие репликативного старения Хейфликом (Hayflick) стало основой предположений, что клеточное и общее старение могут быть причинно связаны. Первичные клетки человека подвергаются ограниченному количеству делений in vitro (предел Хейфлика), что породило клеточно-автономную теорию старения, согласно которой старение истощает ткани компетентных по репликации клеток, необходимых для гомеостаза, репарации и регенерации. Остановка деления в культуре с тех пор стала модельной системой для исследования молекулярных причин и факторов старения, и поиска средств борьбы с ним.

Антивозрастные и геропротекторные препараты должны отвечать следующим критериям: возможность увеличения продолжительности жизни; уменьшение скорости прогрессирования возрастных нарушений; обладать максимальной пользой и приемлемой токсичностью; повышать качество жизни пожилых людей; повышать сопротивляемость организма к неблагоприятным факторам окружающей среды. Согласно современной классификации геропротекторов [2], их подразделяют на: митохондриально-ориентированные антиоксиданты; модификаторы продуктов гликирования (AGE); ингибиторы продуктов перекисного окисления липидов (ALE); миметики ограничения калорий; эпигенетические модуляторы; иммуномодуляторы; гормоны и гормоноподобные вещества.

Сенолитики (от senile – дряхлый и lytic – лизирующий, разрушающий) можно отнести к эпигенетическим модуляторам. Это класс противовозрастных лекарственных препаратов, отличительной особенностью которых является способность избирательно инициировать апоптоз (запрограммированную гибель) постаревших клеток. Препаратами, как правило, выступают малые молекулы, находящиеся на стадии исследований, нацеленных на оценку их способности избирательно вызывать гибель стареющих клеток и улучшать здоровье людей [1, 3, 4]. Целью обычно является обнаружение или разработка средств для отсрочки, предотвращения, облегчения или обращения заболеваний, связанных с возрастом [4, 5]. Связанное с этим понятие «сеностатический», что означает подавление старения. В настоящее время к потенциальным сенолитиками относят ряд препаратов, таких, как комбинация противоопухолевого препарата дазатиниба с антиоксидантом кверцетином [6], ингибиторы различных членов семейства анти-апоптозный белков bcl-2 [6], флавоноид фисетин [7], стимуляторы апоптоза навитоклакс (ABT263) [8] и ABT-737 [9], пиперлонгумин (piperlongumine, PL) – вещество из плодов перца длинного (Piper longum) [8], ингибиторы белка теплового шока Hsp90 [3], макролидные антибиотики азитромицин и рокситромицин [10], «SENSOlytic platform», которая обеспечивает селективное удаление стареющих клеток, маркером которых является p16 [11], и пептиды FOXO4, которые могут связываться с белком р53, вызывая клеточное старение [9]. Молекулы, конкурирующие с FOXO4, могут действовать как сенолитики.

FOXO4 (Forkhead box protein O4) представляет собой белок, который у человека кодируется пептидным геном FOXO4. Он расположен на длинном плече Х-хромосомы в положениях с 71096148 по 71103533. Известно еще три представителя семейства FOXO –FOXO1, FOXO3 и FOXO6. Действие этих белков регулируется посттрансляционными процессами – ацетилированием, убиквитинированием и фосфорилированием, что оказывает влияние на различные клеточные пути, такие, как ответ на оксидативный стресс, продолжительность жизни, реакция на инсулин, прогрессия клеточного цикла и апоптоз. Два основных регулятора белка FOXO4 – это фосфоинозитид-3-киназа (PI3K) и серин/треонин-киназа AKT/PKB. Факторы транскрипции FOXO являются нисходящими эффекторными молекулами сигнального пути инсулиноподобного фактора роста. Каскад превращений FOXO может инициировать генетические пути, связанные с долголетием, что было показано на Caenorhabditis elegans [12, 13]. Такая активация ведет к продлению жизни червей, насекомых и мышей.

Первый представитель семейства FOX был обнаружен у мушек Drosophila Детлефом Вейгелем и Гербертом Якле (Detlef Weigel, Herbert Jäckle) [14, 15]. С тех пор было выявлено большое количество родственных белков, особенно у позвоночных. Первоначально им были даны совершенно разные названия (такие как HFH, FREAC и fkh), но в 2000 году была введена единая номенклатура, которая сгруппировала белки FOX в подклассы (FOXA-FOXS) на основе их последовательностей [16].

Накопление непоправимых клеточных повреждений в результате острого стресса или естественного старения ухудшает здоровье. Считается, что стареющие клетки нарушают функцию тканей, а их генетический клиренс может замедлять процессы гибели. Выявление того, как стареющие клетки избегают апоптоза, позволяет рассчитать конструкцию новых молекул-геропротекторов.

Неустранимое повреждение ДНК может нарушать клеточную функцию, способствовать развитию болезни и ускорять старение. Чтобы предотвратить такие нежелательные последствия, клетки оснащены целым рядом механизмов репарации ДНК. Однако эти механизмы не безупречны. Когда восстановление исчерпано, целостность тканей все еще поддерживается независимыми механизмами реакции на стресс, такими как апоптоз и клеточное старение. Стареющие клетки постоянно выводятся из клеточного цикла и, как правило, развивают стойкий провоспалительный фенотип SASP. SASP влияет на клеточную микросреду, которая может быть полезной в раннем возрасте или в условиях острого заживления ран. Однако, в отличие от апоптотических клеток, которые удаляются навсегда, стареющие клетки могут преобладать в течение продолжительных периодов времени и накапливаться с возрастом. Считается, что из-за низкого, но хронического SASP, устойчивые стареющие клетки ускоряют старение и появление заболеваний, связанных с возрастом. Действительно, старение было связано с множеством (возрастных) патологий, и, наоборот, генетический клиренс стареющих клеток может задерживать признаки старения. Остается в значительной степени неясным, как поврежденные клетки избегают апоптоза в пользу старения. Авторы работы [9], опубликованной в высокорейтинговом журнале Cell, решили изучить этот вопрос и определить, может ли терапевтическое воздействие на стареющие клетки не только задержать, но и противодействовать потере гомеостаза тканей после острых разрушительных медицинских воздействий, таких как химиотерапия или хронических повреждений, вызванных ускоренным или естественным старением.

Чтобы идентифицировать потенциальные центры жизнеспособности стареющих клеток, авторы начали исследование с определения изменений путей, связанных с апоптозом, в стареющих клетках. РНК-секвенирование образцов геномностабильных первичных человеческих фибробластов IMR90 и IMR90 провели после индицирования старения ионизирующим излучением. Поскольку стареющие клетки, устойчивы к апоптозу, ожидалось, что проапоптотические гены будут репрессированы. Однако старение IMR90 показало активацию известных проапоптотических «инициаторов» PUMA и BIM, в то время как антиапоптотический BCL-2 был снижен. Стареющие клетки IMR90 подвергаются апоптозу, но выполнение программы смерти сдерживается. Такой механизм потенциально может быть регулятором транскрипции. Поэтому интерес был направлен на фактор FOXO4, который ранее не был изучен. FOXO хорошо изучены при старении и гомеостазе тканей как мишени для передачи сигналов инсулин/IGF и регуляторы активных форм кислорода. Принимая во внимание, что излучение, вызывающее старение, проявляло только умеренные эффекты на экспрессию FOXO1 и 3, экспрессия мРНК и белка FOXO4 прогрессивно увеличивалась. Поэтому было интересно, может ли FOXO4 уравновесить старение и апоптоз. Авторы ингибировали экспрессию FOXO4 с использованием лентивирусной shRNA. Ингибирование FOXO4 до индукции старения приводило к высвобождению митохондриального цитохрома C и BAX/BAK-зависимого расщепления каспазы-3. Кроме того, ингибирование FOXO4 в клетках, которые уже были стареющими, снижало жизнеспособность и плотность клеток. Это показывает, что, после острого повреждения, FOXO4 способствует старению по сравнению с апоптозом и поддерживает жизнеспособность стареющих клеток, подавляя их реакцию на апоптоз.

Вмешательство в передачу сигналов FOXO4 может быть стратегией по уничтожению стареющих клеток и, таким образом, потенциально нацеливаться на заболевания, связанные со старением. Однако репрессию FOXO4, опосредованную shRNA, было бы сложно перенести в клинику. Таким образом, авторы [9] решили разработать соединения, которые могли бы структурно мешать работе FOXO4. Эксперименты показали, что FOXO4 постепенно рекрутируется в очаги эухроматина после индукции старения.

Белок p53 контролирует как апоптоз, так и старение, и локализуется в DNASCARS в стареющих клетках. В этих условиях p53 фосфорилируется с помощью ATM по Ser15, что блокирует его деградацию, опосредованную MDM2. В соответствии с наблюдением, FOXO4 локализовался рядом с фосфорилированными субстратами ATM и pS15-фосфорилированным p53. Это подняло вопрос, может ли FOXO4 поддерживать жизнеспособность стареющих клеток путем связывания p53 и ингибирования p53-опосредованного апоптоза в пользу остановки клеточного цикла.

FOXO могут взаимодействовать с p53, и домен взаимодействия был охарактеризован с помощью ЯМР. Поэтому, чтобы помешать взаимодействию FOXO4-p53, авторы [9] создали пептид, включающий часть домена FOXO4, взаимодействующего с p53.

Исследования в области химии пептидов показали, что белковые домены, содержащие природные L-пептиды, иногда можно имитировать, используя D-аминокислоты в обратной последовательности. Модификация пептидов до изоформы DRI (D-Retro Inverso) способна придать пептидам новые химические свойства, которые могут повысить их эффективность in vitro и in vivo, что легло в основу создания пептида FOXO4 в конформации DRI, далее именуемой FOXO4-DRI. FOXO4-DRI с молекулярной массой 5358,2 Да разработан в Медицинском центре Университета им. Эразма Роттердамского (Нидерланды) в 2016 г. и состоит из следующей аминокислотной последовательности в D-изоформе: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG

Таким образом, этот пептид является D-ретроинвертированной изоформой для пептида GRKKRRQRRRPPPRKGGSRRNAWGNQSYAELISQAIESAPEKRLTL, в котором все аминокислоты находятся в L-изоформе [17].

Для экспериментов in vitro FOXO4-DRI растворяли в фосфатно-солевой буфере (PBS) с получением 2 мМ стокового раствора. Для применения in vivo FOXO4-DRI растворяли в PBS с получением исходного раствора с концентрацией 5 мг/мл, который хранили на льду и перед инъекцией доводили до комнатной температуры. Препарат вводили три раза в день через день внутрибрюшинно по 5 мг/кг FOXO4-DRI.

FOXO4-DRI конкурирует с FOXO4 за связывание с р53 в зависимости от дозы и делает это с более высокой аффинностью. FOXO4-DRI эффективно проникает в стареющие клетки при высоких внутриклеточных концентрациях, которые остаются избыточными и стабильными в течение длительного периода времени.

FOXO4 может регулировать экспрессию p53-мишени p21cip1 в стареющих клетках, а через p21cip1 p53 может индуцировать p16in4a-независимую остановку клеточного цикла в стареющих клетках. Более того, р53 может индуцировать апоптоз либо посредством трансактивации генов проапоптоза, но также и независимо от транскрипции путем транслокации в митохондрии. Изучение показало, что FOXO4-DRI снижал связанные с старением уровни p21Cip1 и способствовал накоплению и ядерному исключению активного pSer15-p53. Вместе, эти результаты показывают, что, конкурируя с эндогенным FOXO4 за связывание p53, FOXO4-DRI разрушает связанный со старением FOXO4/PML/DNA-SCARS и вызывает исключение активного p53 в ядре клетки. Учитывая заявленную проапоптотическую роль активного р53 в митохондрии, авторы затем оценили его влияние на жизнеспособность стареющих клеток. Инкубация состаренных и контрольных клеток IMR90 с повышением концентрации FOXO4-DRI показала, что FOXO4-DRI мощно и избирательно (с разницей в 11,73 раза) снижает жизнеспособность состаренных и контрольных IMR90 и других нормальных клеток. Измерения плотности клеток в реальном времени показали, что эффект наступает через 24–36 часов после введения препарата. Ни тот же самый пептид в L-изоформе, ни неродственный DRI-пептид на основе белка FOXM1, не влияли на жизнеспособность состаренных клеток. Эти результаты показывают, что FOXO4-DRI может нацеливаться на стареющие клетки, и подчеркивают важность модификации DRI для его эффективности. Таким образом, в схеме обработки, где оба соединения добавляли в последовательных циклах более низких концентраций, FOXO4-DRI оказался селективным в отношении старения, но безопасным для нормальных клеток. Эти данные показывают, что FOXO4-DRI мощно и избирательно снижает жизнеспособность стареющих клеток, конкурируя со связыванием FOXO4-p53, тем самым вызывая высвобождение активного р53 в цитозоль и индуцируя апоптоз, свойственный клеткам, посредством каспазы-3/7. Это делает FOXO4-DRI подлинным индуктором направленного апоптоза стареющих клеток.

Учитывая эффективность FOXO4-DRI против старения in vitro, авторы [9] задались вопросом, может ли FOXO4-DRI быть терапевтически полезным против патологий, связанных со старением, и поэтому использовали три независимые модели старения in vivo – одну для хемотоксичности, одну – для ускоренного старения и одну – для естественного старения.

Нецелевая токсичность ограничивает максимально переносимую дозу химиотерапевтических препаратов и вызывает долговременные проблемы со здоровьем у выживших после рака, включая ускорение старения. Авторы [9] использовали распространенный химиотерапевтический препарат доксорубицин, который может вызывать старение и токсичен для печени грызунов и людей. Доксорубицин-состаренные клетки демонстрировали активацию FOXO4. Низкие эффективные дозы FOXO4-DRI хорошо переносились в нормальных клетках IMR90 по сравнению с ABT-737, при этом они были очень эффективны против доксорубицин-состаренных клеток при более высоких дозах. Активность FOXO4-DRI была более выраженной при последовательном применении. Инкубация нормальных IMR90 с FOXO4-DRI, вводимым в различные моменты времени до воздействия доксорубицина, не влияла на чувствительность клеток к доксорубицину. Напротив, доксорубицин-состаренные клетки были эффективно уничтожены.

Таким образом, FOXO4-DRI не предрасполагает здоровые клетки к повреждению ДНК, но избирательно воздействует на подвергшиеся старению в результате предшествующего воздействия доксорубицина.

Подобную схему введения FOXO4-DRI исследовали in vivo на мышах, подвергшихся воздействию доксорубицина. Мыши XpdTTD / TTD демонстрируют ускоренную потерю волос. Авторы [9] наблюдали значительное улучшение плотности шерсти у этих мышей, получавших FOXO4-DRI. Для количественной оценки определяли температуру поверхности брюшной полости у мышей, измеренную в инфракрасном диапазоне. Из-за отсутствия меха температура у мышей XpdTTD/TTD была на несколько градусов выше, чем у дикого типа, и эффект уменьшился с помощью FOXO4-DRI. Второе неожиданное наблюдение было сделано в поведении обработанных мышей. Принимая во внимание, что мыши XpdTTD / TTD, как правило, демонстрируют менее выраженное исследовательское поведение по сравнению с однопометными животными дикого типа, животные, получавшие FOXO4-DRI, были заметно более активными. Авторы количественно оценили чувствительность мышей к легким физическим стимулам. Мыши XpdTTD/TTD были в среднем значительно более чувствительными к таким стимулам после обработки FOXO4-DRI. Также, исследователи отслеживали добровольную физическую активность в клетках со свободным доступом к беговым колесам. Несмотря на значительные индивидуальные различия, было обнаружено, что мыши XpdTTD/TTD в среднем пробегали 1,37 км/день против 9,37 км/день для мышей дикого типа. Воздействие на мышей FOXO4-DRI увеличивало беговую активность с течением времени у большинства из них.

Эти результаты показывают, что FOXO4-DRI может уменьшить клеточное старение и противодействовать выпадению волос и общей слабости у быстро стареющих мышей XpdTTD/TTD.

FOXO4-DRI также противодействует потере почечной функции у быстро стареющих мышей.

Таким образом, FOXO4-DRI снижает уровень стареющих клеток с высокой экспрессией SASP, которые естественным образом развивались в почках быстро стареющих мышей XpdTTD/TTD, и при этом восстанавливает почечный гомеостаз, о чем свидетельствует среднее снижение концентрации мочевины в плазме более чем на 50% и уровня креатинина – почти на 25%. Это сопровождалось снижением маркеров старения и воспаления в почках. FOXO4-DRI также противодействует слабости и потере почечной функции у мышей естественного возраста [9]. Данное исследование добавило новый препарат в краткий список известных сенолитических соединений, обладающих терапевтической активностью у мышей. Клинические испытания на людях, если методы лечения окажутся успешными, могут открыть новую главу в медицине [9, 18].

Отметим, что работа [9] за три года, по данным базы Google Scholar, была процитирована не менее 428 раз, что говорит о ее прорывном характере.

FOXO4-DRI уменьшает возрастную недостаточность секреции тестостерона, воздействуя на стареющие клетки Лейдига у пожилых мышей [19].

Поздний гипогонадизм у мужчин является возрастным заболеванием, основным механизмом которого является дисфункция стареющих клеток Лейдига. Чтобы исследовать роль FOXO4 в процессе старения клеток Лейдига, авторы [19] сравнили экспрессию FOXO4 в яичках молодых (<30 лет) и старых (≥ 65 лет, согласно критериям ВОЗ) мужчин. Анализ методом Вестерн-блот не выявил существенных различий в уровнях FOXO4 между этими двумя группами. Однако FOXO4 был преимущественно локализован в цитоплазме клеток Лейдига от молодых людей, но в ядре – у пожилых. Это позволяет предположить, что активность FOXO4 участвует в старении клеток Лейдига. В пожилых яичках клетки экспрессировали меньше 3β-гидроксистероиддегидрогеназы (3β-HSD), фермента, ограничивающего скорость синтеза тестостерона. Результаты позволяют предположить, что локализация FOXO4 в ядре может способствовать старению клеток Лейдига и снижению регуляции синтеза тестостерона. Обнаружено, что FOXO4 был экспрессирован в клетках Лейдига человека и его перемещение в ядро ​​у пожилых людей было связано со снижением синтеза тестостерона. Используя в качестве модели in vitro клетки Лейдига TM3, старение которых индуцировали перекисью водорода, авторы показали, что FOXO4 поддерживает жизнеспособность стареющих клеток Лейдига и подавляет их апоптоз. У старых мышей FOXO4 преимущественно экспрессировался в цитоплазме и обнаруживал ядерную локализацию в некоторых клетках Лейдига. Затем пожилым мышам внутрибрюшинно вводили FOXO4-DRI (5 мг/кг) в PBS или PBS по три инъекции в день через день. Через тридцать дней после лечения не было значительной разницы в массе тела или массе яичка между обработанными FOXO4-DRI мышами и контрольной группой. Примечательно, что уровни тестостерона в сыворотке были увеличены у мышей, получавших FOXO4-DRI. Разрушая взаимодействие FOXO4-p53, FOXO4-DRI, специфический блокатор FOXO4, избирательно индуцировал выключение p53 в ядре и вызывал апоптоз в стареющих клетках Лейдига. У мышей естественного возраста FOXO4-DRI улучшал микроокружение яичка и уменьшал возрастную недостаточность секреции тестостерона. Эти данные показывают терапевтический потенциал FOXO4-DRI для лечения позднего гипогонадизма у мужчин.

Несмотря на крайне ограниченную информацию по применению FOXO4-DRI на животных и полному отсутствию экспериментов на людях, в сети имеются отзывы о применении пептида добровольцами. Например, на ресурсе FIGHT AGING! [20] имеются отзывы испытывающих FOXO4-DRI. Опираясь на практическое руководство для пересчета дозы между животными и человеком [21], в котором их относительная площадь поверхности является ключевым параметром для масштабирования, предполагается, что дозировка составит 420 мкг/кг FOXO4-DRI (трифторацетатная соль не рекомендована) путем инъекции, на основании того, что мышам в известном эксперименте [9] вводили 5 мг/кг FOXO4-DRI (см. выше). Но следует понимать, что неизвестны побочные эффекты на человеке; коммерчески-доступные препараты могут не обладать необходимой чистотой.

В целом, FOXO4-DRI показал себя как перспективный препарат, и очевидно, что необходимо проведение серьезных клинических испытаний, отвечающих современным критериям безопасности и достоверности, на людях.

1.         Childs, B.G., Durik, M., Baker, D.J., van Deursen, J.M., Cellular senescence in aging and age-related disease: from mechanisms to therapy. Nature Medicine, 2015. 21(12): p. 1424-1435. DOI: 10.1038/nm.4000.

2.         Yanar, K., Novel Classification Perspective of Geroprotective and Senolytic Drugs as an Antiaging Strategy, in Molecular Basis and Emerging Strategies for Anti-aging Interventions, S.I. Rizvi, Çakatay, U., Editors. 2018, Springer Singapore: Singapore. p. 83-96.

3.         Li, W., Qin, L., Feng, R., Hu, G., Sun, H., He, Y., Zhang, R., Emerging senolytic agents derived from natural products. Mechanisms of Ageing and Development, 2019. 181: p. 1-6. DOI: 10.1016/j.mad.2019.05.001.

4.         van Deursen, J.M., Senolytic therapies for healthy longevity. Science, 2019. 364(6441): p. 636. DOI: 10.1126/science.aaw1299.

5.         Kirkland, J.L., Tchkonia, T., Zhu, Y., Niedernhofer, L.J., Robbins, P.D., The Clinical Potential of Senolytic Drugs. Journal of the American Geriatrics Society, 2017. 65(10): p. 2297-2301. DOI: 10.1111/jgs.14969.

6.         Hernandez-Segura, A., Nehme, J., Demaria, M., Hallmarks of Cellular Senescence. Trends in Cell Biology, 2018. 28(6): p. 436-453. DOI: 10.1016/j.tcb.2018.02.001.

7.         Yousefzadeh, M.J., Zhu, Y., McGowan, S.J., Angelini, L., Fuhrmann-Stroissnigg, H., Xu, M., Ling, Y.Y., Melos, K.I., Pirtskhalava, T., Inman, C.L., McGuckian, C., Wade, E.A., Kato, J.I., Grassi, D., Wentworth, M., Burd, C.E., Arriaga, E.A., Ladiges, W.L., Tchkonia, T., Kirkland, J.L., Robbins, P.D., Niedernhofer, L.J., Fisetin is a senotherapeutic that extends health and lifespan. EBioMedicine, 2018. 36: p. 18-28. DOI: 10.1016/j.ebiom.2018.09.015.

8.         Shoemaker, A.R., Mitten, M.J., Adickes, J., Ackler, S., Refici, M., Ferguson, D., Oleksijew, A., Connor, J.M., Wang, B., Frost, D.J., Bauch, J., Marsh, K., Tahir, S.K., Yang, X., Tse, C., Fesik, S.W., Rosenberg, S.H., Elmore, S.W., Activity of the Bcl-2 Family Inhibitor ABT-263 in a Panel of Small Cell Lung Cancer Xenograft Models. Clinical Cancer Research, 2008. 14(11): p. 3268. DOI: 10.1158/1078-0432.CCR-07-4622.

9.         Baar, M.P., Brandt, R.M.C., Putavet, D.A., Klein, J.D.D., Derks, K.W.J., Bourgeois, B.R.M., Stryeck, S., Rijksen, Y., van Willigenburg, H., Feijtel, D.A., van der Pluijm, I., Essers, J., van Cappellen, W.A., van Ijcken, W.F., Houtsmuller, A.B., Pothof, J., de Bruin, R.W.F., Madl, T., Hoeijmakers, J.H.J., Campisi, J., de Keizer, P.L.J., Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging. Cell, 2017. 169(1): p. 132-147.e116. DOI: 10.1016/j.cell.2017.02.031.

10.       Ozsvari, B., Nuttall, J.R., Sotgia, F., Lisanti, M.P., Azithromycin and Roxithromycin define a new family of “senolytic” drugs that target senescent human fibroblasts. Aging, 2018. 10(11): p. 3294-3307. DOI: 10.18632/aging.101633.

11.       The Science of SENSOlytics®. Oisin Biotechnologies. 2020; Available from: https://www.oisinbio.com/#the-science-of-sensolytics.

12.       Neumann-Haefelin, E., Qi, W., Finkbeiner, E., Walz, G., Baumeister, R., Hertweck, M., SHC-1/p52Shc targets the insulin/IGF-1 and JNK signaling pathways to modulate life span and stress response in C. elegans. Genes & Development, 2008. 22(19): p. 2721-2735.

13.       Kenyon, C., Chang, J., Gensch, E., Rudner, A., Tabtiang, R., A C. elegans mutant that lives twice as long as wild type. Nature, 1993. 366(6454): p. 461-464. DOI: 10.1038/366461a0.

14.       Weigel, D., Jürgens, G., Küttner, F., Seifert, E., Jäckle, H., The homeotic gene fork head encodes a nuclear protein and is expressed in the terminal regions of the Drosophila embryo. Cell, 1989. 57(4): p. 645-658. DOI: 10.1016/0092-8674(89)90133-5.

15.       Weigel, D., Jäckle, H., The “fork head” domain: A novel DNA binding motif of eukaryotic transcription factors? Cell, 1990. 63(3): p. 455-456. DOI: 10.1016/0092-8674(90)90439-L.

16.       Kaestner, K.H., Knochel, W., Martinez, D.E., Unified nomenclature for the winged helix/forkhead transcription factors. Genes & Development, 2000. 14(2): p. 142-146.

17.       WO 2016118014 A2, 2016.

18.       Serrano, M., Tools to eliminate senescent cells. Nature, 2017. 545(7654): p. 294-295. DOI: 10.1038/nature22493.

19.       Zhang, C., Xie, Y., Chen, H., Lv, L., Yao, J., Zhang, M., Xia, K., Feng, X., Li, Y., Liang, X., Sun, X., Deng, C., Liu, G., FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging, 2020. 12(2): p. 1272-1284. DOI: 10.18632/aging.102682.

20.       How to Plan and Carry Out a Simple Self-Experiment, a Single Person Trial of Senolytic Peptide FOXO4-DRI. 2018; Available from: https://www.fightaging.org/archives/2018/03/how-to-plan-and-carry-out-a-simple-self-experiment-a-single-person-trial-of-senolytic-peptide-foxo4-dri/.

21.       Nair, A.B., Jacob, S., A simple practice guide for dose conversion between animals and human. J Basic Clin Pharm, 2016. 7(2): p. 27-31. DOI: 10.4103/0976-0105.177703.