Восоритид при низкорослости (карликовости)

Глепаглутид и синдром короткой кишки
15.10.2020
Пептидные антитоксины при ядовитых укусах
02.11.2020

Ахондроплазия, разновидность карликовости, ведет к серьезным осложнениям и снижает качество жизни. Для лечения этого заболевания разработан новый пептидный препарат, восоритид, который успешно прошел три фазы клинических исследований. В настоящем обзоре рассмотрены история разработки препарата и основные результаты его испытаний.

Ахондроплазия (карликовость)

Ахондроплазия, разновидность карликовости, – наиболее распространенная стойкая дисплазия скелета с непропорциональным ростом. Частотой встречаемости составляет от 1 из 10000 до 1 из 30000 чел. [1], и примерно 250000 случаев в мире [2]. Хотя ахондроплазия может передаваться по наследству через аутосомно-доминантные мутации в гене рецептора фактора роста фибробластов 3 (FGFR3), большинство людей, около 80%, с ахондроплазией имеют de novo мутации [1]. В норме, FGFR3 при активации одним из специфических белков подавляет рост хрящевой и костной ткани посредством ингибирования развития хондроцитов, клеток, которые создают и поддерживают необходимый для роста костей хрящевой матрикс. Мутации FGFR3 ведут к его постоянной активности, что подавляет хондроциты и, как следствие, рост костей [3]. Мутации, вызывающие ахондроплазию (приблизительно 99%), возникают в одном и том же нуклеотиде и приводят к замене глицина на аргинин (Gly380Arg) в трансмембранном домене белка FGFR3 [4].

Своевременная диагностика ахондроплазии является ключом к лечению ранних осложнений у детей. Пренатальная диагностика может быть проведена с помощью молекулярного анализа мутаций в FGFR3 при наличии семейного анамнеза или подозрении на скелетную дисплазию по результатам УЗИ. Большинству пациентов диагноз ставится в раннем постнатальном периоде на основании клинических и рентгенологических характеристик, таких как низкий рост, короткие конечности и аномалии рук и черепа. В последнее десятилетие большинство диагнозов подтверждалось молекулярным анализом мутаций [2].

Помимо ранних признаков ахондроплазии, по мере взросления пациента становятся очевидными другие особенности скелета и различные осложнения. Общая частота осложнений достигает не менее 10% [1]. Люди с ахондроплазией сохраняют низкий рост на протяжении всей жизни, средний рост взрослого больного составляет около 120 см у женщин и 130 см – у мужчин [2]. Другие типичные осложнения напрямую связаны с аномальными размерами и формой костей или являются их вторичными проявлениями. Стеноз краниоцервикального канала может вызвать миелопатию шейки матки. Внешние признаки или симптомы сдавления ствола головного или спинного мозга могут включать устойчивый клонус, глубокую гипотонию, асимметричные рефлексы, затрудненное глотание или рвоту, а также задержку развития. Также может присутствовать стеноз яремного отверстия, который вызывает гидроцефалию. Развиваются дополнительные спинальные проявления, такие как грудопоясничный кифоз и поясничный гиперлордоз, и, хотя они могут исчезнуть в детстве, могут способствовать стенозу спинного мозга и требовать хирургического вмешательства. Признаки и симптомы стеноза позвоночного канала часто проявляются в подростковом возрасте и становятся более серьезными в зрелом, что приводит к боли, кривоногости, хромоте и ограниченной подвижности позвоночника. Различия в развитии лицевых костей (гипоплазия средней зоны лица) и основания черепа часто вызывают обструктивное апноэ во сне, дисфункцию среднего уха, хронический средний отит и синусит, а также неправильный прикус зубов. Дисфункция среднего уха приводит к потере слуха, которая часто связана с задержкой речи. Взрослые с ахондроплазией подвержены высокому риску смерти, что, как считается, связано с сердечно-сосудистыми заболеваниями, обусловленными пониженной подвижностью и ожирением. Было обнаружено, что люди с ахондроплазией в среднем имеют более низкие показатели физического и психического здоровья, что указывает на отрицательное влияние заболевания на качество жизни. Пациенты с ахондроплазией также ежедневно сталкиваются с социальными проблемами и сложностями в окружающей обстановки, рассчитанной на средний рост; это обусловлено маленьким ростом и аномалиями скелета. Последнее может приводить к дискриминации и снижению самооценки. Некоторые осложнения связаны с болью и снижением физических функций, что снижает способность выполнять повседневную деятельность. Адаптируемость людей с ахондроплазией к среде, рассчитанной на людей среднего роста, ограничена [2].

Известен ряд методов лечения ахондроплазии, направленных на коррекцию роста [1], но эффективность их не высока. Терапия гормоном роста не оказывает существенного влияния на взрослого человека. Хирургическое удлинение конечностей может улучшить пропорции тела и увеличить конечный рост на 20 см, но требует многократных операций с высокой частотой осложнений и нагрузкой на организм. До недавнего времени лечение ахондроплазии заключалось лишь в профилактике и лечении осложнений. Одним из новых перспективных средств для терапии ахондроплазии является восоритид.

Восоритид и его свойства

Восоритид (Vosoritide, BMN-111, L-prolylglycyl-(human C-type natriuretic peptide-(17-53)-peptide (CNP-37)), cyclic-(23-39)-disulfide natriuretic peptide; CAS 1480724-61-5) – экспериментальный пептидный препарат для лечения ахондроплазии. Он представляет собой модифицированный рекомбинантный натрийуретический пептид С-типа человека (CNP), состоящий из 39 аминокислот, включающих 37 C-концевых остатков последовательности CNP человека плюс две аминокислоты (Pro-Gly) на N-конце, который получают с помощью генетически модифицированной Escherichia coli [5]. Отметим, что вазоактивный гормон CNP был впервые выделен в 1990 году [6]. Предшественник CNP человека состоит из 103 аминокислотных остатков с биологически активным зрелым CNP на С-конце. За редким исключением, все типы CNP состоят из 22 аминокислотных остатков и обладают внутримолекулярным кольцом из 17 аминокислот, но не имеют С-концевой хвостовой последовательности. Некоторые исследователи предложили исследовать использование CNP для лечения нарушений роста [6].

Пептидная последовательность восоритида следующая: Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC) (Рис. 1, дисульфидный мостик между остатками цистеина в положениях 23 и 39 выделен красным, подчеркнут в формуле).

Рисунок 1 – Структурная формула восоритида

 Восоритид был разработан компанией BioMarin Pharmaceutical [7] и в настоящее время является единственным лекарственным средством, для лечения ахондроплазии, которое получило статус орфанного препарата в странах ЕС [8]. Восоритид, будучи близким аналогом природного CNP, подавляет действие сверхактивного FGFR3 [3, 9].

Изначально влияние пептида была продемонстрирована на животных. Эффективность ослабления фенотипа карликовости у мышей Fgfr3Y367C/+ экспериментально оценивали in vivo [3]. Мышам Fgfr3Y367C/+ и Fgfr3+/+ с возраста 7 дней вводили восоритид один раз в день в течение 10 или 20 дней. Значительное уменьшение признаков карликовости было отмечено после 10 дней у мышей, получавших 240 или 800 мг/кг восоритида (Рис. 2), и включало увеличение размера тела, более длинный хвост и уплощение черепа. Через 10 дней применения пептида измерение различных сегментов тела у мышей Fgfr3Y367C/+, получавших 240 или 800 мг/кг, выявило дозозависимый рост бедренной кости (3,4% или 5,2%, соответственно) и длины носа (4,5% и 5,3%, соответственно). Значительный рост большеберцовой кости (6,6%), передне-заднего диаметра черепа (4,8%) и хвоста (9,8%) наблюдался при дозировке 800 мг/кг [3]. Эти данные простимулировали дальнейшее изучение нового аналога CNP в качестве экспериментального средства лечения ахондроплазии.

Рисунок 2 – Мыши Fgfr3Y367C/+ с фенотипом карликовости из контрольной группы (слева) и группы, получавшей 800 мг/кг восоритида (справа) (фотографии адаптированы из [3])

Последующие эксперименты на мышах и яванских макаках (Macaca fascicularis) показали хороший профиль безопасности пептида [10]. На основании результатов этого исследования, была определена максимальная доза восоритида (8,25 нмоль/кг/день), которую затем выбрали для долгосрочного исследования [10].

Результаты клинических исследований восоритида

В 2014 года стартовали клинические исследования фазы II, в течение которых ученые оценили безопасность и профиль побочных эффектов восоритида у детей (возраст 5–14 лет) с ахондроплазией [9]. В общей сложности 35 детей были включены в четыре последовательные когорты для введения восоритида один раз в день подкожно в дозе 2,5 мкг на килограмм массы тела (8 пациентов в когорте 1), 7,5 мкг/кг (8 пациентов в группе 2), 15,0 мкг/кг (10 пациентов в когорте 3) или 30,0 мкг/кг (9 пациентов в когорте 4). Через 6 месяцев доза в когорте 1 была увеличена до 7,5 мкг/кг, а затем до 15,0 мкг/кг, а в когорте 2 – до 15,0 мкг/кг; пациенты в когортах 3 и 4 продолжали получать начальные дозы. Через 24 месяца поиск оптимальной дозировки был завершен, и 30 пациентов из этих когорт были включены в продолжающееся долгосрочное расширенное исследование; средняя продолжительность наблюдения в обоих исследованиях составила 42 месяца. В течение периодов лечения в расширенных исследованиях и по подбору доз нежелательные явления наблюдались у 35 из 35 пациентов (100%), а серьезные нежелательные явления – у 4 из 35 пациентов (11%). Побочные эффекты включали обструктивное апноэ во сне 3 степени, гипертрофию миндалин 1 степени, кисту щитовидной железы 3 степени и сиринкс (киста спинного мозга) 3 степени. Другие нежелательные проявления были менее серьезными и включали головную боль, боль в спине, низкое кровяное давление и кожные реакции в месте инъекции. Терапия была прекращена у 6 пациентов (у одного – из-за нежелательного действия). Ответы в виде антител к восоритиду были обнаружены у 14 из 35 пациентов (40%). Нейтрализующие антитела появились у 2 пациентов. При этом, связи между наличием антител к препарату и частотой или тяжестью гиперчувствительности или реакцией в месте инъекции не наблюдалось [9].

В течение первых 6 месяцев лечения наблюдалось дозозависимое увеличение скорости роста в годовом исчислении при применении восоритида в дозе 15,0 мкг/кг, а устойчивое увеличение скорости роста – при дозах 15,0 и 30,0 мкг/кг в срок до 42 месяцев [9]. Никакой разницы в эффективности или безопасности между дозами 15,0 и 30,0 мкг/кг обнаружено не было, поэтому было рекомендовано применять низшую дозу в последующих исследованиях. Таким образом, подкожное введение восоритида было связано с рядом побочных эффектов, которые в целом были признаны незначительными. Лечение привело к устойчивому увеличению скорости роста в годовом исчислении на срок до 42 месяцев. Однако оставалось неизвестным, продлится ли эффект препарата достаточно долго, чтобы нормализовать рост детей [11].

Восоритид вызвал ускорение роста в клиническом испытании, в котором участвовало 26 детей [12]. Десять пациентов, получивших высшую дозу 15,0 мкг/кг, выросли на 6 см за полгода по сравнению с 4 см за шесть месяцев, предшествовавших началу эксперимента. Ни в одной когорте во время исследования не было зарегистрировано серьезных нежелательных явлений. Несмотря на увеличение роста, пропорции тела, такие как отношение длины ног к длине верхней части тела, не изменилось ни в худшую, ни в лучшую стороны [11, 12].

В августе 2020 года была принята в печать статья, описывающая результаты рандомизированного, двойного слепого, плацебо-контролируемого, многоцентрового исследование восоритида фазы III, проведенного на детях с ахондроплазией (EudraCT, № 2015-003836-11) [13]. Подкожное введение восоритида один раз в сутки сравнивали с плацебо. Испытание проводилось в 24 больницах в семи странах: Австралии, Германии, Японии, Испании, Турции, США и Великобритании. Включенные в эксперимент пациенты в возрасте от 5 до 18 лет имели клинический диагноз ахондроплазии и лечились амбулаторно, до начала эксперимента они участвовали в течение 6 месяцев в базовом исследовании роста. Участники получали либо восоритид по 15,0 мкг/кг, либо плацебо, вводимые путем ежедневных подкожных инъекций на дому квалифицированными специалистами на протяжении 52-недельного периода лечения. Первичной конечной точкой было изменение по сравнению с исходным уровнем среднегодовой скорости роста на 52 неделе у леченных пациентов против контрольной группы.

Все участники, 121 пациент, прошедшие скрининг на соответствие критериям отбора, были распределены случайным образом так, что 60 получали восоритид и 61 – плацебо. Из них, 119 пациентов завершили 52-недельное исследование. Скорректированная средняя разница в среднегодовой скорости роста между пациентами в группе восоритида и плацебо составила 1,57 см/год в пользу восоритида. Всего в обеих группах было по крайней мере по одному нежелательному явлению. Ни один из серьезных побочных эффектов не считался связанным с лечением; летальных исходов не было. Так, было продемонстрировано, что восоритид является эффективным средством для увеличения роста детей с ахондроплазией [13]. Однако, пока неизвестно, будет ли увеличен окончательный рост взрослого человека и каков может быть вред от долгосрочной терапии.

Заключение

Как видно из результатов клинических испытаний, восоритид является достаточно эффективным и безопасным средством для лечения больных ахондроплазией, особенно в детском возрасте. Возможно, что дальнейшие эксперименты подтвердят его способность нормализовать рост человека при его взрослении. Поразительно, но успешные испытания восоритида породили дискуссию о неэтичности его применения [14]. Ряд людей, страдающих ахондроплазией, а также некоторые родители детей с таким диагнозом заявили, что карликовость не является заболеванием и, следовательно, не требует лечения [14]. Обсуждение вопроса продолжается и сейчас [15]. Противники применения восоритида считают, что это проблема здравоохранения, а «лечение не является “лекарством”», поскольку речь идет всего лишь «об облегчении некоторых симптомов и улучшении качества жизни». С медицинской точки зрения вполне очевидно, что заболевание, ведущее к множественным тяжелым осложнениям, включая инвалидизацию и смерть, определенно требует применения всех доступных методов и средств для его излечения.

1.         Unger, S., Bonafé, L., Gouze, E., Current Care and Investigational Therapies in Achondroplasia. Current Osteoporosis Reports, 2017. 15(2): p. 53-60. DOI: 10.1007/s11914-017-0347-2.

2.         Okenfuss, E., Moghaddam, B., Avins, A.L., Natural history of achondroplasia: A retrospective review of longitudinal clinical data. American Journal of Medical Genetics Part A, 2020. 182(11): p. 2540-2551. DOI: 10.1002/ajmg.a.61825.

3.         Lorget, F., Kaci, N., Peng, J., Benoist-Lasselin, C., Mugniery, E., Oppeneer, T., Wendt, Dan J., Bell, Sean M., Bullens, S., Bunting, S., Tsuruda, Laurie S., O’Neill, Charles A., Di Rocco, F., Munnich, A., Legeai-Mallet, L., Evaluation of the Therapeutic Potential of a CNP Analog in a Fgfr3 Mouse Model Recapitulating Achondroplasia. The American Journal of Human Genetics, 2012. 91(6): p. 1108-1114. DOI: 10.1016/j.ajhg.2012.10.014.

4.         Legeai-Mallet, L., Savarirayan, R., Novel therapeutic approaches for the treatment of achondroplasia. Bone, 2020: p. 115579. DOI: https://doi.org/10.1016/j.bone.2020.115579.

5.         International Nonproprietary Names for Pharmaceutical Substances (INN): List 112. WHO Drug Information, 2014. 28 (4): p. 539. DOI: https://www.who.int/medicines/publications/druginformation/PL112-final.pdf.

6.         Tsukada, T., Subchapter 32C – C-type Natriuretic Peptides, in Handbook of Hormones, Y. Takei, Ando, H., Tsutsui, K., Editors. 2016, Academic Press: San Diego. p. 286-e232C-283.

7.         BioMarin Pharmaceutical Inc. 2020; Available from: https://www.biomarin.com/about/history/.

8.         EU/3/12/1094. 2013; Available from: https://www.ema.europa.eu/en/medicines/human/orphan-designations/eu3121094.

9.         Savarirayan, R., Irving, M., Bacino, C.A., Bostwick, B., Charrow, J., Cormier-Daire, V., Le Quan Sang, K.-H., Dickson, P., Harmatz, P., Phillips, J., Owen, N., Cherukuri, A., Jayaram, K., Jeha, G.S., Larimore, K., Chan, M.-L., Huntsman Labed, A., Day, J., Hoover-Fong, J., C-Type Natriuretic Peptide Analogue Therapy in Children with Achondroplasia. New England Journal of Medicine, 2019. 381(1): p. 25-35. DOI: 10.1056/NEJMoa1813446.

10.       Wendt, D.J., Dvorak-Ewell, M., Bullens, S., Lorget, F., Bell, S.M., Peng, J., Castillo, S., Aoyagi-Scharber, M., O’Neill, C.A., Krejci, P., Wilcox, W.R., Rimoin, D.L., Bunting, S., Neutral Endopeptidase-Resistant C-Type Natriuretic Peptide Variant Represents a New Therapeutic Approach for Treatment of Fibroblast Growth Factor Receptor 3–Related Dwarfism. Journal of Pharmacology and Experimental Therapeutics, 2015. 353(1): p. 132. DOI: 10.1124/jpet.114.218560.

11.       Vosoritid. 2015; Available from: https://arznei-news.de/vosoritid/.

12.       BMN 111 (vosoritide) Improves Growth Velocity in Children With Achondroplasia in Phase 2 Study. 2015; Available from: https://investors.biomarin.com/2015-06-17-BMN-111-vosoritide-Improves-Growth-Velocity-in-Children-With-Achondroplasia-in-Phase-2-Study.

13.       Savarirayan, R., Tofts, L., Irving, M., Wilcox, W., Bacino, C.A., Hoover-Fong, J., Ullot Font, R., Harmatz, P., Rutsch, F., Bober, M.B., Polgreen, L.E., Ginebreda, I., Mohnike, K., Charrow, J., Hoernschemeyer, D., Ozono, K., Alanay, Y., Arundel, P., Kagami, S., Yasui, N., White, K.K., Saal, H.M., Leiva-Gea, A., Luna-González, F., Mochizuki, H., Basel, D., Porco, D.M., Jayaram, K., Fisheleva, E., Huntsman-Labed, A., Day, J., Once-daily, subcutaneous vosoritide therapy in children with achondroplasia: a randomised, double-blind, phase 3, placebo-controlled, multicentre trial. The Lancet, 2020. 396(10252): p. 684-692. DOI: 10.1016/S0140-6736(20)31541-5.

14.       Pollack, A. Drug Accelerated Growth in Children With Dwarfism, Pharmaceutical Firm Says. 2015; Available from: https://www.nytimes.com/2015/06/18/business/drug-accelerated-growth-in-children-with-dwarfism-pharmaceutical-firm-says.html.

15.       Saner, E. ‘There is a fear that this will eradicate dwarfism’: the controversy over a new growth drug. 2020; Available from: https://www.theguardian.com/science/2020/sep/28/there-is-a-fear-that-this-will-eradicate-dwarfism-the-controversy-over-a-new-growth-drug.