Антимикробный пептид LL-37

Пептидные антитоксины при ядовитых укусах
02.11.2020
Японский пероральный нейропептид Талтирелин
21.11.2020

Антимикробные пептиды (АПМ) – часть естественной защитной системы организма. В настоящее время известно более 8 тыс. природных и синтетических пептидных последовательностей АМП. Настоящий обзор посвящен одному из перспективных АМП – LL-37, обладающему противомикробной и ранозаживляющей активностью, а также потенциально полезному в лечении коронавирусной инфекции COVID-19.

Антимикробные пептиды

Антимикробные пептиды (AMP, АМП) представляют собой природные соединения, которые составляют часть важного механизма врожденного иммунитета организма, защищающего от патогенных микроорганизмов, таких как грамположительные и отрицательные бактерии, грибы и вирусы. АМП – это короткие пептиды, обычно состоящие из менее чем 50 аминокислот, которые проявляют антимикробную активность широкого спектра в физиологических условиях. Многие из этих пептидов были обнаружены при наблюдении антимикробных свойств некоторых жидкостей и секретов живых организмов. Таким образом, естественные АМП считаются важной частью врожденного иммунитета. Кроме того, с развитием информатики применительно к разработке лекарств, были разработаны многие синтетические АМП. Согласно базе данных антимикробных пептидов (CAMPR3, Collection of Anti-Microbial Peptides) [1]), на сегодняшний день зарегистрировано 8164 последовательностей и 757 структур. Одним из таких активных соединений является LL-37.

Свойства пептида LL-37

LL-37 (ALL-38 peptide, antibacterial peptide LL-37, CAMP protein, cathelicidin-1, CAS 54947-66-7) представляет собой антимикробный пептид массой 4493,34 Да, в молекуле которого 37 аминокислотных остатков представлены в следующей последовательности: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa]).

Предшественником LL-37 является препропептид массой 19,3 кДа, который, после потери своей сигнальной последовательности, называется hCAP-18. Благодаря наличию кателинового домена hCAP-18, его относят к семейству кателицидинов. Как и другие кателицидины, обнаруженные в нейтрофилах свиней, крупного рогатого скота, кролика и мыши, кателиновый домен hCAP18 является высококонсервативным и предшествует домену, кодирующему антимикробный пептид. Человеческий hCAP-18 конститутивно экспрессируется в нейтрофилах и в семенниках, и индуцируется кератиноцитами [2].

Кателицидин часто экспрессируется клетками, находящимися в прямом контакте с окружающей средой. Экспрессия была обнаружена в эпителиальных клетках кишечника, дыхательных путей, гениталий, поверхности глаза и кожи, а также в эккринных (потовых) железах [3, 4]. Так, пептиды кателицидина образуют первый рубеж защиты от бактерий.

LL-37 представляет собой защитный пептид, образующийся отщеплением с С-конца калетицидина человека, hCAP18. Этот пептид был впервые обнаружен в лейкоцитах и семенниках, позже его нашли во многих различных типах клеток и жидкостях организма, с высокой секрецией в макрофагах (клетки-киллеры и тучные клетки) и нейтрофилах – подвижных клетках, гранулоцитах, относящихся к лейкоцитам и являющихся основой врожденного иммунитета, и обладает противомикробными, противоопухолевыми, противовирусными и иммуномодулирующими свойствами [5]. Кроме того, экспрессия LL-37 была обнаружена в лимфоцитах, мезенхимальных стволовых клетках и строме костного мозга [3]. Экспрессия является конститутивной или индуцируется контактом с бактериями или составляющими их клеточной стенки, нарушением барьера эпителиальных клеток, стрессом эндоплазматического ретикулума, а также при инфекциях и ранах. Активация рецептора витамина D является важным регулятором экспрессии кателицидина [3]. Исследования подтвердили роль витамина D3, продемонстрировав корреляцию между пониженным уровнем витамина D3 и туберкулезом.

Цитотоксичный как для бактериальных, так и для нормальных эукариотических клеток, LL-37 весьма устойчив к протеолитической деградации в растворе. Кроме того, было показано, что LL-37 играет роль в хемоаттракции, дифференцировке дендритных клеток, дегрануляции тучных клеток, секреции цитокинов, стимуляции ангиогенеза. LL-37 также исследовали как ранозаживляющее средство. У других видов животных С-концевая антимикробная область различается по размеру, последовательности и структуре.

LL-37 был открыт в 1995 году исследователями из Национальной университетской больницы Rigshospitalet (Копенгаген, Дания) в процессе изучения hCAP18 [6]. Довольно быстро анализ показал, что зрелый пептид LL-37 – мощный антибактериальный агент [7].

Человеческие нейтрофилы содержат два структурно различных типа антимикробных пептидов, дефенсины (от HNP-1 до HNP-4) и α-спиральный пептид LL-37 [2]. В целом LL-37 менее эффективен, чем PG-1, однако LL-37 проявляет значительную активность (MIC, <10 мкг/мл) против Pseudomonas aeruginosa, Salmonella typhimurium, Escherichia coli, Listeria monocytogenes, Staphylococcus epidermidis, Staphylococcus aureus и устойчивых к ванкомицину энтерококков [2]. LL-37 вызывал проницаемость внешней и внутренней мембран E. coli ML-35p. Также, LL-37 с высоким сродством связывался с липополисахаридом E. coli O111:B4 (LPS). Широкий спектр антимикробных свойств LL-37, его присутствие в нейтрофилах и его индуцируемость в кератиноцитах предполагают, что этот пептид и его предшественник, hCAP-18, могут защищать кожу и другие ткани от проникновения бактерий и токсичности, вызванной липополисахаридом LPS бактерий. Сильная активность LL-37 против P. aeruginosa, включая мукоидные и устойчивые к антибиотикам штаммы, предполагает, что он или родственные молекулы могут быть полезны в качестве местных бронхолегочных микробицидов при муковисцидозе [2].

Кателицидин человека и LL-37 также проявляют противовирусную активность. Они нацелены на вирусы гриппа, осповакцины, простого герпеса 1, аденовирус 19 и ВИЧ-1 (см. ссылки в обзоре [3]). Антивирусный эффект обусловлен тем, что кателицидины способны ингибировать эти вирусы путем прямого взаимодействия с мембранной оболочкой и белковым капсидом. LL-37 и фрагменты LL-37(13–37) и LL-37(17–32) способны блокировать действие обратной транскриптазы ВИЧ-1 путем прямого связывания. Было установлено, что правильная первичная структура и спиральность важны для противовирусного эффекта. Помимо прямого взаимодействия, кателицидины способны вызывать мощный иммунный ответ в антигенпрезентирующих клетках. LL-37 и другие катионные пептиды усиливают доставку вирусной дцРНК к Toll-подобным рецепторам, расположенным в эндосомных компартментах рядом с ядром. Это приводит к продукции и высвобождению интерферонов типа I и созреванию дендритных клеток.

Несколько групп ученых исследовали роль кателицидинов в иммунитете и при различных заболеваниях. Благодаря сходству генов, структуры, антимикробной активности и тканевого распределения, данные, полученные для мышиного пептида кателицидина, могут быть переведены на человеческий пептид LL-37 [3]. Нокаутные мыши, лишенные гена кателицидина, демонстрируют повышенную восприимчивость к бактериальной и вирусной инфекции, в результате в более высокой заболеваемости и смертности. Также наблюдается усиление хронического аллергического воспаления и развития атеросклероза. Нокдаун гена кателицидина привел к относительно повышенной восприимчивости к микробной инфекции. На моделях воспалительного заболевания кишечника мышей, таких как колит, кателицидин вызывает заживление, что указывает на его терапевтический потенциал. У людей экспрессия кателицидина подавляется при кожных заболеваниях, таких как атопический дерматит и хронические язвы, аномально высокие уровни кателицидина экспрессируются при кожных заболеваниях, таких как псориаз и розацеа [3]. Кателицидины связаны с противоопухолевым действием, но также описаны опухолевые эффекты, которые могут быть связаны с неконтролируемой пролиферацией, ангиогенезом и ингибированием апоптоза. Исследования показали, что кателицидины могут играть важную роль в индукции или уничтожении раковых клеток и могут предоставить новые возможности для разработки терапевтических средств против рака [3].

LL-37 влияет на накопление иммунных клеток в очаге воспаления и фенотип макрофагов

 Помимо антимикробных функций, LL-37 также выполняет иммуномодулирующую роль [4]. Действительно, как провоспалительные, так и противовоспалительные функции LL-37 могут модулироваться микросредой и фоном болезни. Например, присутствие 10 мг/мл LL-37 во время дифференцировки моноцитов в макрофаги способствует провоспалительному ответу, что приводит к снижению уровня IL-10 и повышению уровня IL-12p40. Кроме того, LL-37 направляет дифференцировку макрофагов в сторону фенотипа M1; так присутствие этого пептида оказывает сильное влияние на развитие макрофагов и продукцию цитокинов. Кроме того, воздействие LL-37 увеличивает выработку воспалительных цитокинов за счет передачи сигналов IL-1b. Противовоспалительные свойства LL-37 демонстрируются его антагонистическим действием на ответы IFN-g, TNF-α, IL-4 и IL-12 в различных типах клеток. Сильный противовоспалительный ответ через модуляцию передачи сигналов TLR также приписывают пептиду LL-37. Примечательной особенностью LL-37 является то, что он также обладает различными хемотаксическими свойствами и модулирует выработку хемокинов, т. е., способен влиять на направление движения бактерий. Действуя через рецептор 2 формилпептида, LL-37 вызывает миграцию нейтрофилов и эозинофилов. Другие рецепторы, связанные с G-белком, аналогичным образом активируются LL-37 и могут вносить вклад в хемотаксические эффекты этого пептида. Трансактивация рецептора эпидермального фактора роста с помощью LL-37 вызывает миграцию кератиноцитов, что способствует заживлению ран. LL-37 способен индуцировать транскрипцию CXCL8 и взаимодействует с TNF-α-опосредованной экспрессией этого хемокина. MCP-1/CCL-2, фактор рекрутирования моноцитов, секретируется дозозависимым образом после действия LL-37. Кроме того, TGF-β, высвобождаемый из эпителиальных клеток кишечника после воздействия LL-37, также имеет важные хемотаксические эффекты для миграции эпителиальных клеток и заживления ран. Таким образом, LL-37, высвобождаемый в месте инфекции или повреждения ткани, может стимулировать воспалительную реакцию и инициировать заживление [4].

LL-37 и сигнальные пути TLR

TLR представляют собой рецепторы, которые отвечают за молекулярные паттерны, ассоциированные с патогенами. Нарушение регуляции передачи сигналов TLR важно в развитии аутоиммунных реакций. Действие LL-37 на TLR может рассматриваться как противовоспалительное. LL-37 подавляет передачу сигналов через TLR4 за счет связывания его лиганда, LPS, а также прерывания функции рецепторного комплекса TLR4 в дендритных клетках (DC) и макрофагах. Это приводит к более низким уровням выработки провоспалительных цитокинов. Подобное подавление высвобождения хемокинов было отмечено в линиях эпителиальных клеток. В зависимости от последовательности взаимодействий LL-37 и LPS, эффекты могут быть провоспалительными. Когда на макрофаги действует LPS до LL-37, происходит усиленное высвобождение TNF-α. Кроме того, активируются инфламмасомы и выработка IL-1b и IL-18. Способность LL-37 оказывать подавляющее действие на эффекты LPS зависит от времени и контекста, в котором клетки подвергаются воздействию. LL-37 стабилизирует лиганды TLR3 и способен усиливать ответ на активность вирусов в бронхиальных эпителиальных клетках. Модуляция ответов TLR3 в кератиноцитах ведет к репрессии активации цитокинов CXCL10 и CCL5, но усилению CXCL8 [4].

LL-37 модулирует ответ IFN типа I

Интерфероны IFN типа I – важная частью врожденного иммунного ответа на действие микробов. Они способствуют созреванию миелоидных DC и активации лимфоцитов и NK-клеток. IFN типа I также повышены при многих аутоиммунных заболеваниях, таких как волчанка, дерматомиозит и псориаз, и, вероятно, вносят свой вклад в патогенез заболевания. Синтез IFN типа I происходит через распознавание нуклеиновых кислот патогенов рецепторами TLR7 и TLR9. Эффекты LL-37 на пути синтеза IFN типа I следующие: LL-37 (10 мМ) способен связывать ДНК и действовать как переносчик нуклеиновых кислот через мембраны. Взаимодействия LL-37 с ДНК могут способствовать потере толерантности к ДНК и синтезу IFN типа I, что может привести к аберрантным иммунным ответам. Аналогичные механизмы индукции IFN типа I были продемонстрированы для LL-37 в комплексе с собственной РНК, высвобождаемой из умирающих клеток [4].

LL-37 регулирует другие воспалительные сигнальные пути

Активация P2X7R, индуктора активации инфламмасом в макрофагах и моноцитах, считается уникальной функцией LL-37. Эта стимуляция приводит к активации как IL-1b, так и IL-18. Кроме того, стимуляция этого рецептора с помощью LL-37 увеличивает экспрессию COX2 и продукцию PGE2 в фибробластах десен человека. Была описана стимуляция высвобождения IL-8 и CXCL3 в кератиноцитах посредством активации киназных путей. Сообщалось также об активации с помощью LL-37 рецептора инсулиноподобного фактора роста 1, приводящей к активации пути MAPK/ERK [4].

LL-37 регулирует гибель клеток

Эффекты LL-37 на регуляцию гибели клеток могут зависеть от типа вовлеченных клеток и контекста, в котором происходит стимуляция. LL-37 ингибирует активацию каспазы-3 и каспазы-8 и индукцию апоптоза в нейтрофилах. Более высокие дозы пептида вызывают некротическую гибель нейтрофилов. Эпителиальные клетки, такие как кератиноциты, также защищены от апоптоза за счет активации COX-2 с помощью LL-37. Предварительная инкубация с LL-37 защищает культуры эпителиальных клеток кишечника от TRAIL-опосредованного апоптоза. Первичные эпителиальные клетки дыхательных путей и остеобласты более восприимчивы к проапоптотическим эффектам умеренных доз LL-37 [4].

Роль LL-37 в аутоиммунном псориазе

Уровни LL-37 повышены в псориатической коже. Псориаз характеризуется воспалением кожи, пролиферацией кератиноцитов, усилением сигнатур IFN типа I и сверхэкспрессией LL-37. Важно отметить, что LL-37 при этом заболевании может способствовать патогенезу. Комплексы LL-37/ДНК генерируют стабильные лиганды, которые могут снижать толерантность и стимулировать TLR9 в псориатических дермальных pDC. Это приводит к усилению регуляции IFN типа I и дальнейшей активации воспалительного пути. Кроме того, LL-37 оказывает антиапоптотическое действие на кератиноциты, возможно, способствуя повышенной клеточной пролиферации, присутствующей при этом заболевании. Полагают, что LL-37 защищает кератиноциты от dsDNA-опосредованной активации инфламмасомы AIM2. Таким образом, присутствие повышенных уровней LL-37 в псориатической коже может сместить баланс в сторону от «классических» медиаторов воспаления (таких как IL-1b) и вызвать патологию, обусловленную ответами IFN I типа [4]. Исследования роли LL-37 в патогенезе псориаза продолжаются.

Роль LL-37 в системной красной волчанке

 Системная красная волчанка (СКВ) – синдром, который может привести к тяжелым поражениям органов. Этиология СКВ остается неясной, но пути IFN типа I, по-видимому, вносят важный вклад в развитие заболевания. Нейтрофилы при СКВ ориентированы на экстернализацию ДНК и других иммуностимулирующих молекул за счет усиленного синтеза и нарушения деградации внеклеточных ловушек нейтрофилов (NET). В связи с этим, важна роль LL-37 в стабилизации иммунных комплексов у пациентов с СКВ. Этот пептид защищает ДНК от деградации. Циркулирующие иммунные комплексы антител, ДНК и LL-37 способны стимулировать TLR9 в pDC, что приводит к продукции IFN типа I. Кроме того, пациенты с СКВ демонстрируют аутоантитела к LL-37, способствующие формированию иммунных комплексов. Эти аутоантитела способны индуцировать NET, тем самым поддерживая воспалительный цикл и обеспечивая стимуляцию выработки IFN типа I. Также потенциально способствует патогенезу СКВ провоспалительное действие LL-37 на макрофаги. LL-37 стимулирует активацию инфламмасом, что приводит к продукции IL-1b и IL-18. Уровень IL-18 повышен у пациентов с СКВ и коррелирует с активностью заболевания и маркерами сердечно-сосудистых заболеваний. Активация инфламмасом в ответ на LL-37 усиливается в макрофагах M1, полученных от пациентов с СКВ, что приводит к повышенной выработке IL-18, который может дополнительно способствовать воспалительному циклу, приводящему к развитию заболевания. При поражениях кожи волчанкой была описана активация нескольких АМП, включая LL-37, однако эффекты остаются неизвестными. Предполагают, что АМП могут обеспечивать защиту от кожной инфекции у пациентов с красной волчанкой кожи, но требуются дальнейшие исследования роли LL- 37 [4].

Роль LL-37 при артрите и в костном метаболизме

 Повышенная экспрессия LL-37 описана у пациентов с ревматоидным артритом. LL-37 вызывает апоптоз остеобластов, что может способствовать снижению образования костной ткани, остеопении, в пораженных суставах. Кроме того, описана повышенная экспрессия LL-37 в остеокластах и ​​гранулоцитах синовиальной оболочки. Используя модель индуцированного артрита у крыс, была продемонстрирована активация rCRAMP, крысиного ортолога LL-37, в гранулоцитах, макрофагах и gd-T-клетках синовиальной жидкости. Перенос нейтрофилов, подвергшихся воздействию пристана, вызывал артрит, тогда как ответы на IFN типа I или аутоантитела у контрольных крыс не наблюдались. Таким образом, LL-37 может способствовать развитию артрита. Было высказано предположение о связи между заболеванием пародонта и развитием артрита. Уровни LL-37 повышены в зубодесневой жидкости пациентов с хроническим заболеванием пародонта и могут играть роль в развитии воспаления десен. Воздействие сигаретного дыма усиливает ферментативную активность пептидиларгининдезиминазы 2, что приводит к усиленному цитруллинированию белков, включая LL-37, что увеличивает хемотаксические свойства [4].

LL-37 и другие аутоиммунные заболевания

LL-37 может играть потенциально защитную роль в развитии саркоидоза, что объясняют эффектам TNF-α, которые отрицательно влияют на экспрессию LL-37 в альвеолярных макрофагах. Кроме того, в выделениях из носа пациентов с гранулематозом с ангиопатией (гранулематоз Вегенера, потнециальный патоген – Staphylococcus aureus) обнаруживается значительно повышенный уровень LL-37. Однако еще предстоит определить, являются ли при этом заболевании повышенные уровни этого пептида провоспалительными или защитными [4].

Роль LL-37 при атеросклерозе

Атеросклероз считается воспалительным заболеванием, при котором активируются сигнальные пути врожденного иммунитета. Предполагают, что LL-37, связанный с иммунными комплексами, стимулируют развитие атеросклероза. Транскрипция LL-37 повышена в атеросклеротической аорте человека. LL-37 играет важную роль в привлечении воспалительных клеток к бляшкам, а также в модуляции цитокиновой среды, способствуя развитию атеросклеротических поражений. LL-37 также влияет на эндотелиальные клетки и индуцирует повышающую регуляцию ICAM-1, который участвует в рекрутировании воспалительных клеток в бляшки. Более того, он может быть протромботическим в контексте атеросклеротических поражений. Интересно, что при использовании для покрытия коронарных стентов LL-37, он предотвращал ретромбоз внутри стента за счет стимулирования реэпителизации. Таким образом, действие LL-37 на атеросклероз двойственно – он усиливает атеросклеротическое воспаление, но может способствовать заживлению сосудов [4].

Потенциал терапевтического использования LL-37

Учитывая исследования роли LL-37 в аутоиммунных заболеваниях, эта молекула потенциально может быть также направлена на модуляцию иммунитета. Нейтрализация передачи сигналов TLR4 показала себя многообещающей при таких заболеваниях, как колит, хроническая боль и сепсис. Учитывая влияние LL-37 на этот рецептор, он может иметь терапевтический потенциал при заболеваниях, на которые влияет TLR4. Для заболеваний, при которых LL-37 может способствовать передаче сигналов TLR7 и TLR9, таких как псориаз и СКВ, антагонизм к этому пептиду может быть терапевтической мишенью. Поскольку LL-37 способен участвовать в образовании иммунных комплексов, следует проявлять осторожность, когда рассматриваются попытки нейтрализовать этот пептид. Кроме того, необходимо тщательно изучить последствия блокировки LL-37 на противомикробную защиту.

Благодаря своим антимикробным свойствам, АМП стали многообещающей мишенью для разработки лекарств в качестве альтернативы системным антибиотикам. Однако некоторые исследователи предупреждают, что воздействие синтетических пептидов может вызвать устойчивость микробов к врожденной защите человека. Действительно, различные антибиотики с кателицидиноподобными свойствами могут способствовать устойчивости микробов к LL-37 [4].

Несмотря на неоднозначную роль LL-37 во многих заболеваниях, к 2020 году было проведено более 75 исследований с прямым или косвенным изучением антимикробных эффектов LL-37. В работах приводились количественные отчеты по минимальной ингибирующей концентрации (MIC), минимальной бактерицидной концентрации (MBC), полумаксимальной ингибирующей концентрации (IC50), 99% эффективной дозе (ED99) и 90% летальной дозе (LD90), 50% ингибированию роста (GI50) и 50% эффективной концентрации (EC50)  [5]. Лишь единичные испытания проведены на людях. Рассмотрим их ниже.

Клинические испытания LL-37 при венозных язвах нижних конечностей

Венозные язвы нижних конечностей являются наиболее распространенным типом хронических ран в западных странах; распространенность варьируются от 0,16% до 0,39%, при этом 1–1,6% населения в возрасте 60 лет и старше страдают от этого в любой момент времени [8]. Язвы являются причиной значительного ухудшения качества жизни пациентов. Основа лечения, обычно, – внешняя компрессионная терапия. При надлежащем лечении, 50–60% выздоравливают более 20–24 недель; сообщается о частоте рецидивов в 30% в течение первого года. Доступные перевязочные материалы имеют очевидное преимущество с точки зрения закрытия раны при использовании в качестве дополнения к таким методам, как очищение, хирургическая обработка раны, контроль экссудата и эластичная компрессионная повязка. Пока нет эффективных пероральных или местных препаратов, предназначенных для лечения трудноизлечимых язв. Следовательно, существует необходимость в определении безопасного и эффективного фармакологического лечения, которое улучшило бы исход лечения хронической язвы ног. Острое повреждение кожи вызывает быстрое высвобождение медиаторов, участвующих в восстановлении тканей и защите от инфекции, включая LL-37.

Исследования на экспериментальных моделях животных подтверждают роль LL-37 как усилителя заживления ран, хотя результаты не совсем согласуются. Местное введение LL-37 стимулировало заживление ран у мышей и свиней, получавших кортикостероид для нарушения нормального заживления. Применение LL-37 в ранах диабетических мышей, характеризуемых нарушением заживления, показало положительный эффект в одном исследовании, в то время как другое исследование не подтвердило какого-либо улучшения. Механизмы, с помощью которых LL37 может способствовать заживлению ран, полностью не выяснены, но, вероятно, включают реэпителизацию, ангиогенез и воспаление.

Целью первого исследования, проведенного на людях, было определение безопасности и дозозависимой эффективности синтетического пептида LL-37 при лечении трудноизлечимых язв [8]. Испытание включало 34 участника (средний возраст 68,6–78,9 лет) с венозными язвами нижних конечностей, и состояло из 3-недельного вводного периода (плацебо), за которым следовала 4-недельная рандомизированная фаза двойного слепого эксперимента с двумя еженедельными аппликациями LL-37 (0,5, 1,6 или 3,2 мг/мл) или плацебо, и последующее наблюдение через 4 недели. Целевую язву очищали водой, марлей и, при необходимости, кюреткой. LL-37 или плацебо в 10,5% вязком растворе ПВС наносили на очищенную и высушенную язву. Плацебо или LL-37 вводили в объеме 25 мкл/см2. Все процедуры применялись дважды в неделю (каждые 3±1 дня), чтобы совпасть с обычными в клинической практике интервалами смены повязок. Период полувыведения LL-37 в хронических ранах неизвестен, но иммунореактивность против LL-37 была обнаружена через 48 часов после нанесения лекарственного препарата на раны у мини-свиней.

Константы скорости заживления для дозировок 0,5 и 1,6 мг/мл LL-37 были примерно в шесть и три раза выше, чем для плацебо. Данные о площади раны показали улучшенное заживление для групп при дозе 0,5 и 1,6 мг/мл по сравнению со значениями до лечения. Соответственно, лечение двумя низкими дозами заметно уменьшало среднюю площадь язвы (68% для группы 0,5 мг/мл и 50% для группы 1,6 мг/мл LL-37). Разницы в заживлении не наблюдалось между группами, получавшими 3,2 мг/мл LL-37 и плацебо. Местное лечение хронических язв ног с помощью LL-37 было безопасным и хорошо переносимым с заметным влиянием на заживление при двух более низких дозах [8].

В настоящее время продолжается клиническое исследование по индукции противоопухолевого ответа у пациентов с меланомой с использованием противомикробного пептида LL–37 (NCT02225366) [9]. В экспериментах LL–37 вводят внутрь кожных или подкожных опухолей диаметром не менее 1 см. Пациенты будут получать еженедельные внутриопухолевые инъекции LL-37 курсом до 8 недель. Инъекции будут делаться каждые 7 дней (+/- 48 часов). Начальная доза LL–37 составляет 250 мкг/опухоль. Планируется также оценить действие крема, содержащего LL-37, на колонизацию бактерий, реакцию на воспаление и скорость заживления язв диабетической стопы (NCT04098562) [9].

Доклинические и клинические испытания LL-37 при COVID-19

Коронавирусная болезнь COVID-19 стала глобальной проблемой и вызвала длительную угрозу безопасности жизни, экономическому развитию и социальной стабильности в более чем 180 странах по всему миру; количество жертв неуклонно увеличивается [10, 11]. К сожалению, до сих пор не существует специального препарата против SARS-CoV-2, поэтому на данном этапе необходимо критически рассматривать все возможные методы лечения. LL-37 – один из наиболее изученных АМП человека, обладающий широким спектром активности против бактерий и вирусов. Использование живых генетически модифицированных (ГМО) организмов является эффективным подходом для доставки терапевтических белков. Целью недавнего исследования было определение безопасности и эффективности бактерии Lactococcus lactis, которая была генетически модифицирован для продуцирования человеческого антимикробного пептида LL-37 (шифр ГМО-продуцента – cas001) у пациентов с COVID-19 [12]. Lactococcus lactis представляет собой непатогенную неколонизирующую бактерию, которая является одним из наиболее часто используемых микроорганизмов в молочной промышленности и имеет отличные показатели безопасности. Генетически модифицированный пробиотик Lactococcus lactis может служить вектором для локальной доставки молекул биологически активных молекул.

На доклинической стадии исследования, авторы [12] сконструировали ГМО-пробиотик пищевого качества с последовательностью из семи тандемных повторов зрелого человеческого LL-37 под контролем низин-индуцируемого промотора nisA для продуцирования cas001. 20 здоровых крыс (по пять самцов и пять самок в контрольной в экспериментальной группах) использовали для наблюдения за острой токсической реакцией и смертью после ежедневного введения cas001 в течение трех недель, чтобы обеспечить необходимую информационную базу для выбора клинической дозы, проверки токсической реакции и возможных органов-мишеней. Согласно расчетной клинической дозе 1×108 КОЕ/кг/день (где КОЕ – колониеобразующие единицы, показатель количества жизнеспособных микроорганизмов на единицу объема), с учетом преобразования площади поверхности тела, дозу для крыс следует умножить на 6,17 до 6×108 КОЕ/кг/день. Исследователи вводили крысам в 100 раз более высокую дозу – 6×1010 КОЕ/кг/день. Для исследования фармакокинетики cas001 самцам крыс (масса тела 250–300 г, 1×1010/животное, n=3) перорально вводили порошок бактерий LL-37. Концентрация LL-37 в крови до и после желудочного зондирования определялась с помощью ELISA. Анализ методом Вестерн-блот показал, что разумное количество LL-37 индуцировалось различными концентрациями низина, что означало успешное конструирование cas001. В тесте на доклиническую оценку безопасности после трехнедельного введения cas001 не наблюдалось побочных эффектов по отношению к массе тела крыс, потреблению пищи и воды, гематологическим или биохимическим параметры сыворотки крови. Результаты показали, что LD50 cas001 была выше, чем у 100-кратной ожидаемой клинической дозы 6×1010 КОЕ/день. Эти результаты в экспериментах на животных показали, что cas001 является безопасным. Кроме того, результаты фармакокинетики на крысах продемонстрировали, что концентрация LL-37 в сыворотке достигла пика через 2 часа после введения cas001 через желудочный зонд и вернулась к базовому уровню через 6 часов [12].

Клиническое исследование на людях было одобрено комитетом по этике, и в общей сложности 11 пациентов с легкими симптомами были включены в испытание в больницах Ухань Ханкоу и Хуошэньшань [12]. Они были включены в исследование добровольно, и все пациенты подписали информированное согласие. Среди них было 5 мужчин и 6 женщин в возрасте 55±12 (36–70) лет, а продолжительность от начала приема лекарства составила 35±19 (5–68) дней. При включении в исследование 6 пациентов были COVID-положительными по нуклеиновым кислотам, а 5 пациентов – отрицательными. Все пациенты получали лечение пероральным препаратом cas001 в соответствии с потребностями (1×109 КОЕ/капсула, 3 капсулы за раз, три раза в день с интервалом в 8 часов в течение 3 недель) со средним сроком наблюдения 33±15 дней.

В течение периода исследования добровольцы не испытывали дискомфорта при приеме капсул cas001, а через два часа после перорального приема концентрация LL-37 была увеличена у здоровых добровольцев. cas001 демонстрирует определенный эффект в облегчении симптомов со стороны желудочно-кишечного тракта и, возможно, оказывает влияние на улучшение системных и респираторных симптомов и может играть роль в улучшении результатов теста на нуклеиновую кислоту коронавируса и КТ легких. 11 включенных в исследование пациентов тщательно следовали предписаниям, активно взаимодействовали с врачами и продемонстрировали хорошую толерантность и субъективные ощущения. Ни у одного из 3 пациентов не было побочных реакций [12].

На момент вовлечения в исследование, симптомы пациентов включали системные симптомы, в основном – лихорадку, усталость и миалгию. После лечения степень улучшения системных симптомов составила 100%, а время от приема лекарств до полной ремиссии составляло от 5 до 33 дней. Респираторные симптомы включали фарингалгию, кашель, недомогание в груди, одышку, которые полностью исчезли через 7–14 дней после лечения со степенью улучшения до 100%. Желудочно-кишечные симптомы, включая дискомфорт в животе, тошноту, плохой аппетит и диарею, полностью исчезли в течение 2–18 дней после лечения. Среди всех симптомов, симптомы со стороны желудочно-кишечного тракта исчезли быстрее всего, а самое короткое время улучшения – 2 дня. Что касается улучшения результатов КТ легких, у 3 пациентов улучшение было полным, а у 1 – на 75%. Потребовалось 7 дней для восстановления от легкого воспаления до его полного исчезновения [12].

Теоретически, лекарства из живых бактерий могут вызывать четыре типа побочных реакций, включая эффекты, связанные с желудочно-кишечным трактом, инфекцию, вредные метаболические проявления, чрезмерную иммунную стимуляцию восприимчивых людей и перенос генов. Клинических данных о возникновении побочных реакций, включая инфекцию, вредный метаболический эффект, побочные реакции со стороны желудочно-кишечного тракта, во время наблюдения не были выявлены ни у одного из пациентов. На основании вышеизложенных результатов, авторы заключили, что cas001 в качестве перорального противовирусного агента продемонстрировал хорошие профили безопасности, но прийти к заключению о клинических исходах, связанных с cas001, оказалось затруднительным, хотя изменения некоторых симптомов указывают на обнадеживающие перспективы данного подхода к лечению COVID-19 [12].

Заключение

С развитием устойчивых к лекарствам бактериальных инфекций, мир быстро движется к постантибиотической эре. Противомикробные пептиды имеют большой потенциал для использования в качестве многообещающей альтернативы антибиотикам. Одним из наиболее широко известных представителей этой группы является пептид с α-спиральной структурой, LL-37, который естественным образом продуцируется многими клетками человека. LL-37 способен бороться с широким спектром устойчивых и чувствительных бактериальных патогенов: грамположительными (Staphylococcus, Streptococcus, Enterococcus, Clostridium, Listeria, Nocardia, Bacillus, Aggregatibacter, Peptostreptococcus, Capnocytophaga и Actinomyces), грамотрицательными (Acinetobacter, Pseudomonas, Escherichia, Salmonella, Klebsiella, Yersinia, Vibrio, Neisseria, Moraxella, Haemophilus, Porphyromonas, Helicobacter, Campylobacter, Preenvotellakterium, Fusvotellakterium, и Stenotrophomonas) и другими (Leptospira, Borrelia, Treponema, Mycoplasma, Ureaplasma и Mycobacterium).

Некоторые из функций LL-37 являются противовоспалительными, особенно те, которые участвуют в блокировании грамотрицательных сигнальных путей. В контексте воспалительного ответа, пептид может также обеспечивать провоспалительные сигналы. LL-37 способствует заживлению язв нижних конечностей.

У пациентов с COVID-19 введение cas001 улучшает клинические результаты. Небольшой размер выборки и неконтролируемый дизайн исследования не позволяют сделать окончательные выводы об эффективности LL-37 (в виде ГМО-продуцента cas001), и очевидно, что требуется дальнейшая оценка в масштабных клинических испытаниях.

1.         Waghu, F.H., Idicula-Thomas, S., Collection of antimicrobial peptides database and its derivatives: Applications and beyond. Protein Science, 2020. 29(1): p. 36-42. DOI: https://doi.org/10.1002/pro.3714.

2.         Turner, J., Cho, Y., Dinh, N.-N., Waring, A.J., Lehrer, R.I., Activities of LL-37, a Cathelin-Associated Antimicrobial Peptide of Human Neutrophils. Antimicrobial Agents and Chemotherapy, 1998. 42(9): p. 2206. DOI: 10.1128/AAC.42.9.2206.

3.         Vandamme, D., Landuyt, B., Luyten, W., Schoofs, L., A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology, 2012. 280(1): p. 22-35. DOI: https://doi.org/10.1016/j.cellimm.2012.11.009.

4.         Kahlenberg, J.M., Kaplan, M.J., Little Peptide, Big Effects: The Role of LL-37 in Inflammation and Autoimmune Disease. The Journal of Immunology, 2013. 191(10): p. 4895. DOI: 10.4049/jimmunol.1302005.

5.         Neshani, A., Zare, H., Akbari Eidgahi, M.R., Kamali Kakhki, R., Safdari, H., Khaledi, A., Ghazvini, K., LL-37: Review of antimicrobial profile against sensitive and antibiotic-resistant human bacterial pathogens. Gene Reports, 2019. 17: p. 100519. DOI: https://doi.org/10.1016/j.genrep.2019.100519.

6.         Cowland, J.B., Johnsen, A.H., Borregaard, N., hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules. FEBS Letters, 1995. 368(1): p. 173-176. DOI: https://doi.org/10.1016/0014-5793(95)00634-L.

7.         Gudmundsson, G.H., Agerberth, B., Odeberg, J., Bergman, T., Olsson, B., Salcedo, R., The Human Gene FALL39 and Processing of the Cathelin Precursor to the Antibacterial Peptide LL-37 in Granulocytes. European Journal of Biochemistry, 1996. 238(2): p. 325-332. DOI: https://doi.org/10.1111/j.1432-1033.1996.0325z.x.

8.         Grönberg, A., Mahlapuu, M., Ståhle, M., Whately‐Smith, C., Rollman, O., Treatment with LL-37 is Safe and Effective in Enhancing Healing of Hard-to-Heal Venous Leg Ulcers: A Randomized, Placebo-Controlled Clinical Trial. Wound Repair and Regeneration, 2014. 22: p. 613-621. DOI: 10.1111/wrr.12211.

9.         ClinicalTrials. 2020; Available from: https://clinicaltrials.gov/.

10.       WHO. Weekly operational update on COVID-19 – 30 October 2020; Available from: https://www.who.int/publications/m/item/weekly-operational-update—30-october-2020.

11.       Wuhan Coronavirus (2019-nCoV) Global Cases. JHU CSSE. 2020; Available from: https://gisanddata.maps.arcgis.com/apps/opsdashboard/index.html#/bda7594740fd40299423467b48e9ecf6.

12.       Zhang, H., Zhao, Y., Jiang, X., Zhao, Y., Li, Y., Li, C., Dong, M., Luan, Z., Yan, C., Jiao, J., Zhao, C., Li, H., Chen, W., Feng, C., Tian, L., Qin, E., Mu, J., Li, C., Zeng, T., Feng, S., Wang, S., Guan, X., Li, T., Yu, H., Zheng, A., Jin, W., Sun, G., Preliminary evaluation of the safety and efficacy of oral human antimicrobial peptide LL-37 in the treatment of patients of COVID-19, a small-scale, single-arm, exploratory safety study. medRxiv, 2020: p. Preprint. DOI: 10.1101/2020.05.11.20064584.