Пептиды группы IGF – допинг и потенциальное лекарство

Новый нейропротектор. FGL пептид
09.11.2019

(IGF-1, IGF-1 LR3, IGF-1 DES)

Пептиды группы IGF – полипептиды, которые играют необходимые роли в росте и развитии. Основным источником циркулирующего IGF-1 является печень. IGF-1 вырабатывается всеми непеченочными тканями [1]. Значительную долю IGF-1 производят скелетные мышцы.

IGF-1 (ранее известный под названием Somatomedin) представляет собой одноцепочечный белок состоящий из 70 аминокислотных остатков [2] [3, 4]:

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

IGF (Insulin-like Growth Factor, Инсулиноподоный Фактор Роста, ИФР)необходим для стимулирования роста и выживания практически всех тканей. IGF-1 и инсулин являются родственными молекулами с весьма схожим действием. Регулирование IGF-I производится как на уровне процесс синтеза РНК при переносе генетической информации с ДНК на РНК, так и в процесс синтеза белка из аминокислот на матрице РНК. При этом могут образовываться разнообразные формы IGF-1.  Транспортировка IGF-1 модулируется многими внеклеточными белками. Также, IGF-1 взаимодействует с другими факторами роста. Этот белок регулирует анаболизм (процессы в живом организме, направленные на образование и обновление структурных частей клеток и тканей) и метаболизм (обмен веществ) [5].

Время полураспада IGF-1 составляет примерно 4 часа от момента инъекционного введения (установлено на крысах) или 69 минут (на мышах) [1, 6] В организме здорового человека полураспад IGF-1 10–12 минут после внутривенного введения 0,2 мкг белка  [7]. Несмотря на это, белок поступает в головной и спинной мозг линейно. В клетки мозга IGF-1 поступает со скоростью 0,4 мкл/г·мин после внутривенной инъекции [8].

IGF-1 является митогенным и антиапоптотическим препаратом, т.е. стимулирует деление и подавляет гибель клеток.  Опухолевые клетки глиомы (рак мозга) человека in vitro подавляются под действием IGF-1, причем при их перевивании на животное in vivo они теряют онкогенность и вызывают специфический иммунный ответ, что приводит к гибели опухолей. Клинические результаты, полученные с глиобластомой и раком толстой кишки, являются также очень многообещающими [9].  Интересно, что данный белок вырабатывается во всех органах плода, что имеет важное значение для роста, дифференциации и развития плода и новорожденного. Некоторые данные свидетельствуют о том, что уровни IGF-1 зависят от массы тела при рождении; кроме того, более высокие уровни IGF-1 связаны с большей массой тела. В зрелом возрасте повышенные концентрации IGF-1 связаны с риском ожирения и некоторых видов рака [10-12]. Рецептор IGF-1R часто (хотя и не всегда) избыточно вырабатывается при многих раковых заболеваниях, об этом свидетельствуют исследования, где показано, что сигналы, исходящие от него, влияют на функции, которые имеют решающее значение для выживания раковых клеток и метастазов [13].

Клинические исследования 2017–2018 гг.  показали (выборка – 40 человек), что индекс массы тела (ИМТ) матери и типа вскармливания младенцев влияет на уровень IGF-1 у новорожденных. Так, существует положительная связь между повышенного уровня IGF-1 и более высоким весом при рождении, что наиболее выражено у младенцев, рожденных от тучных женщин. Это указывает на влияние пептида на обмен веществ в организме человека. Обнаружено, что уровень IGF-1 ниже у грудных детей в возрасте 3 месяцев, которых вскармливают грудью  [10-12].

У пациентов с ожирением коронарный атеросклероз и хроническая недостаточность кровообращения прогрессируют быстрее и имеют более неблагоприятный отдаленный прогноз, чем у лиц с нормальным весом. У пациентов с ожирением относительный дефицит IGF-1 достоверно чаще ассоциируется с гемодинамически значимым поражением коронарных артерий сердца. Следовательно, полипептид мог бы в дальнейшем найти применение для борьбы с ожирением, что, однако, требует проведения клинических исследований. Уровень IGF-1 также может быть полезным индивидуальным индикатором в оценке прогноза ишемической болезнью сердца и хронической недостаточности кровообращения у пациентов с ожирением [14].

Уровень циркулирующего IGF-1 непосредственно регулирует рост и плотность костей. Это было показано на животной модели (мыши с нарушением генов, кодирующих IGF-1 и Als). Рост и развитие мышей наблюдали с недельными интервалами от рождения до 10-недельного возраста, а также определяли уровень гормонов в сыворотке крови   [1].

Физические упражнения положительно влияют на уровень IGF-1, однако это зависит от пола и национальности человека [15].

Дополнительно про IGF-1:

IGF-1 (ИФР-1, Инсулиноподобный Фактор Роста 1)

 

LR3IGF-1 (Long R3 IGF-1, IGF-1 LR3) это аналог IGF-1, содержащий 83 аминокислотных остатка, и, по сути, является человеческим IGF-1, в котором проведена замена аргинина на глютамин в третьем положении, а также добавлены 13 аминокислот к N-концу:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

LR3IGF-1 может способствовать росту или обращать катаболизм более эффективно, чем IGF-1 [16]. Данный белок имеет очень низкое сродство к IGF-связывающим белкам (в 200–1000 раз) и, следовательно, быстрее выводится из кровообращения, чем IGF-I. LR3IGF-1 имеет более короткий период полураспада в крови, почти в два раза, чем IGF-I, и более медленное поступление в мозг [8].

В работе [17] проводили ряд испытаний по изучению гемодинамических эффектов IGF-1 и его аналога LR3IGF-1. При введении IGF-1 в течение 20 минут значительно повышался почечный кровоток (вплоть до 35%) и понижалось артериальное давление на 18%, тогда как при введении аналога оно снижалось на 15%. Во втором исследовании при замерах спустя час артериальное давление снижалось на 25%, кровоток при введении аналога увеличивался на 38%, тогда как при введении IGF-1 он увеличился всего на 58%. значительно увеличился кровоток и снизилось сосудистое сопротивление в скелетных мышцах крыс. Эти гемодинамические изменения были связаны со значительным снижением среднего артериального давления. Сопротивление сосудистой системы мозга также значительно уменьшилось после введения IGF [17]. Очевидно, что эти полипептиды имеют потенциал в качестве средств снижения АД и улучшения кровотока, что может быть полезно при физических нагрузках.

Эксперименты на плодных овцах показали, что LR3IGF-1 стимулирует пролиферацию и дифференцировку кардиомиоцитов. Плодам вводили по 5 мг LR3IGF-1в течение 7 дней. Затем плод умертвляли и измеряли его физические параметры (вес тела, сердца и печени) В результате, было установлено, что введение LR3IGF-1 приводило к снижению процента атипичных двуядерных клеток, являющихся одном из проявлений канцерогенеза [18].

 

Des(1-3)IGF-1 (IGF-1 DES) является природным эндогенным белком и «усеченным аналогом» IGF-1 – в полипептиде отсутствуют первые три аминокислоты на N-конце (всего 67 аминокислот по сравнению с 70 в IGF-1):

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

В результате этого различия его способность к связыванию с инсулиноподобными белками, связывающими факторы роста значительно снижена, причем его активность по стимулированию гипертрофии и пролиферации культивируемых клеток увеличилась (примерно в 10 раз in vitro) и стимулирует рост тела с 3–5-кратной большей эффективностью, чем IGF-I в широком диапазоне исследований на грызунах  по сравнению с IGF-1 [19], однако период полураспада его составляет 2–3 минуты [20]. Аналог Des(1-3)IGF-1 может циркулировать после протеолитического расщепления IGF-1, в результате которого также образует трипептид Gly-Pro-Glu; все три пептида могут оказывать нейрозащитное и нейротрофическое действие после гипоксически-ишемической травмы головного мозга [8].

В работе [21] оценивали влияние IGF-1 и des(1-3)-IGF-1 в мозге крысы в ​​областях потери нейронов после индуцированного гипоксически-ишемического повреждения мозга, вызванного путем перевязки правой сонной артерии. Центральное введение 20 мкг IGF-1 уменьшало потерю нейронов во всех регионах, однако 20 мкг des(1-3)-IGF-1   не снижали потери нейронов. Наблюдалась тенденция к снижению потери нейронов после введения150 мкг des(1-3)-IGF-1. Интересно, что при действии des(1-3)-IGF-1 (40 нг/мл) исследователи наблюдали 40%-ное увеличение возбуждающего постсинаптического потенциала. Эта характеристика острого действия des-IGF-1 на возбуждающие синапсы гиппокампа может дать представление о механизме, с помощью которого длительное увеличение IGF-1 в плазме обеспечивает когнитивные преимущества у пожилых крыс. Такое действие может непосредственно способствовать улучшению когнитивных функций или инициировать долгосрочные изменения в мозге, которые важны для обучения и памяти.

Также известно, что этот аналог может предотвращать ранние биохимические аномалии сетчатки, связанные с прогрессированием диабетической ретинопатии, несмотря на продолжающуюся гипергликемию, что было продемонстрировано на крысах (5 мкг/день, 2 недели) [22].

Предполагается, что локальная секреция IGF-1 регулирует усиленный рост скелетных мышц. Таким образом, «эксперты» в блогах по бодибилдингу постулировали, что экзогенный IGF-1 может быть эффективен для увеличения локального роста мышц при внутримышечном введении [23].

 

Пептидные гормоны роста включены в списки допинг-препаратов антидопингового агентства (WADA). Известно о злоупотреблении такими полипептидами как в любительском, так и профессиональном спорте, особенно тяжелой атлетике и бодибилдинге. IGF-1 пользуется популярностью у спортсменов, в частности – тяжелоатлетов, как допинг [23]. Практикующие введение препарата IGF-1  спортсмены обычно используют каждый второй день по 100 мкг. LR3IGF-1 вводят ежедневно по 50–150 мкг/раз, потеря чувствительности наступает примерно через 40 дней. Des(1-3)-IGF-1  в дозировке 50–150 мкг инъецируют до нескольких раз в день до четырех недель, как правило – перед физической нагрузкой и по ее окончанию. Дозировки для этих полипептидов официально не установлены, и данные взяты из непроверенных источников.

Наглядно сродство всех трех полипептидов изображено на рисунке:

Несмотря на быстрый распад аналогов IGF-1 в крови, они имеют высокий потенциал благодаря более эффективному действию, чем IGF-1. В будущем, возможно, эти полипептиды войдут в клиническую практику для восстановления мышц и связок после получения спортивных травм или при дистрофических состояниях, а также для коррекции обмена веществ. В настоящее время нет данных по клиническим испытаниям этих аналогов на человеке, но, очевидно, что в дальнейшем их подвергнут более детальному изучению.

 

  1. Yakar, S., Rosen, C.J., Beamer, W.G., Ackert-Bicknell, C.L., Wu, Y., Liu, J.-L., Ooi, G.T., Setser, J., Frystyk, J., Boisclair, Y.R., LeRoith, D., Circulating levels of IGF-1 directly regulate bone growth and density. The Journal of Clinical Investigation, 2002. 110(6): p. 771-781. DOI: 10.1172/JCI15463.
  2. Rinderknecht, E., Humbel, R.E., The amino acid sequence of human insulin-like growth factor I and its structural homology with proinsulin. 1978. 253(8): p. 2769-2776.
  3. Cooke, R.M., Harvey, T.S., Campbell, I.D., Solution structure of human insulin-like growth factor 1: a nuclear magnetic resonance and restrained molecular dynamics study. Biochemistry, 1991. 30(22): p. 5484-5491. DOI: 10.1021/bi00236a022.
  4. Pietrzkowski, Z., Wernicke, D., Porcu, P., Jameson, B.A., Baserga, R., Inhibition of Cellular Proliferation by Peptide Analogues of Insulin-like Growth Factor 1. Cancer Research, 1992. 52(23): p. 6447.
  5. Vassilakos, G., Barton, E.R., Insulin-Like Growth Factor I Regulation and Its Actions in Skeletal Muscle. Comprehensive Physiology, 2019. 9: p. 413-438. DOI: 10.1002/cphy.c180010.
  6. Baxter, R.C., Insulin-Like Growth Factor Binding Proteins in the Human Circulation: A Review. Hormone Research in Paediatrics, 1994. 42(4-5): p. 140-144. DOI: 10.1159/000184186.
  7. Hans-Peter, G., Jürgen, Z., Christoph, S., Froesch, E.R., Insulin-like growth factors I and II in healthy man. Acta Endocrinologica, 1989. 121(6): p. 753-758. DOI: 10.1530/acta.0.1210753.
  8. Pan, W., Kastin, A.J., Interactions of IGF-1 with the blood-brain barrier in vivo and in situ. Neuroendocrinology Letters, 2000. 72(3): p. 171-178.
  9. Trojan, L.A., Kopinski, P., Wei, M.X., Ly, A., Glogowska, A., Czarny, J., Shevelev, A., Przewlocki, R., Henin, D., Trojan, J.J.A.B.P.-E.E.-. IGF-I: from diagnostic to triple-helix gene therapy of solid tumors. 2002. 49(4): p. 979-990.
  10. Lineham, J.D., Smith, R.M., Dahlenburg, G.W., King, R.A., Haslam, R.R., Stuart, M.C., Faull, L., Circulating insulin-like growth factor I levels in newborn premature and full-term infants followed longitudinally. Early Human Development, 1986. 13(1): p. 37-46. DOI: 10.1016/0378-3782(86)90096-4.
  11. Hikino, S., Ihara, K., Yamamoto, J., Takahata, Y., Nakayama, H., Kinukawa, N., Narazaki, Y., Hara, T., Physical Growth and Retinopathy in Preterm Infants: Involvement of IGF-I and GH. Pediatric Research, 2001. 50(6): p. 732-736. DOI: 10.1203/00006450-200112000-00017.
  12. Hansen-Pupp, I., Löfqvist, C., Polberger, S., Niklasson, A., Fellman, V., Hellström, A., Ley, D., Influence of Insulin-Like Growth Factor I and Nutrition During Phases of Postnatal Growth in Very Preterm Infants. Pediatric Research, 2011. 69(7): p. 448-453. DOI: 10.1203/PDR.0b013e3182115000.
  13. LeRoith, D., Roberts, C.T., The insulin-like growth factor system and cancer. Cancer Letters, 2003. 195(2): p. 127-137. DOI: 10.1016/S0304-3835(03)00159-9.
  14. Шпагина, О.В., Бондаренко, И.З., Куклина, М.Д., Манченко, О.В., Колесникова, Г.С., Гончаров, Н.П., Гормон роста и инсулиноподобный фактор роста-1 в прогнозе течения ИБС у пациентов с ожирением. Ожирение и метаболизм, 2014. 4: p. 33-40.
  15. Stein, A.M., Silva, T.M.V., Coelho, F.G.d.M., Arantes, F.J., Costa, J.L.R., Teodoro, E., Santos-Galduróz, R.F., Physical exercise, IGF-1 and cognition A systematic review of experimental studies in the elderly. Dementia & Neuropsychologia, 2018. 12: p. 114-122.
  16. Tomas, F.M., Lemmey, A.B., Read, L.C., Ballard, F.J., Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins is maintained when administered by injection. Journal of Endocrinology, 1996. 150(1): p. 77-84. DOI: 10.1677/joe.0.1500077.
  17. Gillespie, C.M., Merkel, A.L., Martin, A.A., Effects of insulin-like growth factor-I and LR3IGF-I on regional blood flow in normal rats. Journal of Endocrinology, 1997. 155(2): p. 351-358. DOI: 10.1677/joe.0.1550351.
  18. Sundgren, N.C., Giraud, G.D., Schultz, J.M., Lasarev, M.R., Stork, P.J.S., Thornburg, K.L., Extracellular signal-regulated kinase and phosphoinositol-3 kinase mediate IGF-1 induced proliferation of fetal sheep cardiomyocytes. American Journal of Physiology-Regulatory, Integrative and Comparative Physiology, 2003. 285(6): p. R1481-R1489. DOI: 10.1152/ajpregu.00232.2003.
  19. John Ballard, F., Wallace, J.C., Francis, G.L., Read, L.C., Tomas, F.M., Des(1–3)IGF-I: a truncated form of insulin-like growth factor-I. The International Journal of Biochemistry & Cell Biology, 1996. 28(10): p. 1085-1087. DOI: 10.1016/1357-2725(96)00056-8.
  20. Pan, W., Kastin, A.J., Interactions of IGF-1 with the Blood-Brain Barrier in vivo and in situ. Neuroendocrinology, 2000. 72(3): p. 171-178. DOI: 10.1159/000054584.
  21. Ramsey, M.M., Adams, M.M., Ariwodola, O.J., Sonntag, W.E., Weiner, J.L., Functional Characterization of Des-IGF-1 Action at Excitatory Synapses in the CA1 Region of Rat Hippocampus. Journal of Neurophysiology, 2005. 94(1): p. 247-254. DOI: 10.1152/jn.00768.2004.
  22. Kummer, A., Pulford, B.E., Ishii, D.N., Seigel, G.M., Des(1–3)IGF-1 Treatment Normalizes Type 1 IGF Receptor and Phospho-Akt (Thr 308) Immunoreactivity in Predegenerative Retina of Diabetic Rats. Experimental Diabesity Research, 2003. 4(1). DOI: 10.1080/15438600303729.
  23. Brennan, B.P., Kanayama, G., Hudson, J.I., Pope, J., Harrison G, Human growth hormone abuse in male weightlifters. The American journal on addictions, 2011. 20(1): p. 9-13. DOI: 10.1111/j.1521-0391.2010.00093.x.