Мезотерапия с пептидами. Мезококтейли

Пептидная реминерализация эмали: новый этап в лечении кариеса
28.06.2021
Мотиксафортид (Motixafortide), онкология, стимуляция стволовых клеток
31.07.2021

Мезотерапия – популярный, минимально инвазивный метод доставки лекарств в слой кожи, который часто применяется в косметических целях. Показаниями для мезотерапии считаются старение, аллопеция и целлюлит. Для мезотерапии применяют специальные коктейли активных веществ, включая пептиды. В обзоре рассмотрена мезотерапия, ее особенности, а также применяемые пептиды или коктейли на их основе, для которых известны результаты доклинических или клинических исследований: гексапептид-3, трипептид-1, ацетилглутамил октапептид-3, пальмитоил тетрапептид-7, пальмитоил пентапептид-4, пальмитоил трипептид-5 и пептиды вилочковой и шишковидной желез.

Мезотерапия и омоложение кожи

Мезотерапия – это нехирургический, минимально инвазивный метод доставки лекарств, который заключается в многократных внутрикожных или подкожных инъекциях смеси или т. н. “коктейля” соединений в низких дозах [1-3]. Для этих целей могут использоваться пептиды, экстракты растений, аминокислоты, витамины, и другие биологически активные вещества. Термин “мезотерапия” происходит от греческих слов “mesos“, означающего “средний” или “серединный”, и “therapeia“, означающего “лечить”, т. е. подразумеваются инъекции в средний слой кожи или “внутрикожная терапия” [4].

История мезотерапии отсчитывается с 1952 года, когда этот подход для облегчения боли и сосудистых заболеваний разработал французский медик М. Пистор. Пистор предложил термин “мезотерапия” и определил его как лечение мезодермы (первичный зародышевый слой, который развивается в соединительную ткань, мышцы и кровеносную систему). В 1976 году Пистор стал основателем Французского общества мезотерапии, Национальная медицинская академия Франции в 1987 году признала мезотерапию как отдельную медицинскую специальность.

Для мезотерапии применяют различное оборудование, от простого шприца до дермороллера; иглы вводят под различными углами, в зависимости от того, в какой слой кожи необходимо доставить препарат (Рис. 1). Поскольку стандартных рекомендаций не существует, обычная процедура требует разметки и очистки целевой области антисептическим средством и обычно занимает от 20 до 30 минут. Различные техники инъекций приведены ниже:

  1. Точка за точкой – также известная как “серийная” техника. Иглы направленны перпендикулярно (90⁰) к коже. Каждая инъекция глубокая (2–4 мм) и делается на расстоянии 1–2 см. Эта техника чаще всего используется при липолизе, когда глубина инъекции может превышать 4 мм, а объем препарата на одну точку инъекции больше 0,2 мл.
  2. Наппаж – инъекции в зону от поверхностных до глубоких слоев дермы с проникновением на глубину от 1 до 4 мм, которые проводятся под углом 30–60⁰, а объем раствора составляет < 0,1 мл.
  3. Папульная техника – инъекции в дермо-эпидермальный стык на глубину 2–4 мм с последующим образованием небольшой папулы. Эта техника более полезна при мезоботоксе и заболеваниях волос.
  4. Внутриэпидермальная техника – более поверхностная обработка, включающая инъекции на глубину до 1 мм. Дозы >0,1 мл приводят к образованию “пятен” из-за растяжения вышележащего эпидермиса, однако при технике “волочения” используются дозы 0,01 мл, что не приводит к образованию пятен. Для техники “волочения” идеально подходит 13-миллиметровая игла, проводимая по коже линейным движением с подергиванием.
  5. Смешанная техника включает в себя комбинацию поверхностных и глубоких инъекций, применяемых в течение одного сеанса для достижения оптимального результата.
  6. Техника колонн натяжения основана на создании векторов натяжения в зонах сильной дряблости или провисания тканей. Целенаправленная доставка 0,5–1 мл мезораствора (мезолифт) вводится внутрикожно в заранее определенные точки –виски, периоральная область и прилегающая к углу нижней челюсти (Рис. 1). После инъекции массаж круговыми движениями против основной кости помогает добиться эффекта “наполнения и подтяжки”.
  7. Безыгольная мезотерапия (NNM) – новая техника, включающая введение ионизированных и нейтральных соединений в слои дермы и подкожной клетчатки посредством электропорации или ультразвука. Она завоевала популярность благодаря своей экономичности, безболезненности с минимальным риском образования синяков, эритемы или отека, и обеспечивает более глубокое проникновение материала, что приводит к ускоренному эффекту.
  8. Мезотерапия микроиглами – на коже создаются микропроколы, например, дермороллером, которые усиливают проникновение активного ингредиента. Кроме того, микротравмы стимулируют тромбоциты, способствуя заживлению и омоложению.

Рисунок 1 – Оборудование для мезотерапии (дермороллер, мезопистолет, иглы), точки и углы введения инъекций

Показания для мезотерапии

Утверждается, что мезотерапия имеет широкий спектр применения, особенно в области косметической дерматологии. Основные и широко практикуемые показания в дерматологии – целлюлит, включая рассасывание жира, и контурирование тела; омоложение кожи, лифтинг и депигментация; андрогенная алопеция и другие проблемы с ростом волос. Ниже приведены примерные параметры для мезотерапии в зависимости от показаний: объем вводимого коктейля, глубина проникновения иглы для мезотерапии и количество сеансов, необходимых для различных целей [5] (Таблица 1). Целлюлит, локальные жировые отложения и омоложение лица обычно демонстрируют хорошие результаты при использовании мезотерапии; телогеновая или андрогенная алопеция, растяжки и пигментация лица лечатся умеренно хорошо, в то время как для скульптурирования или контурирования тела и лечения мелазмы методы мезотерапии имеют сомнительную эффективность.

Таблица 1 – Показания и типичные методы мезотерапии

Пептиды в мезотерапии

Рассматривается возможность применения пептидов в составе мезотерапевтических коктейлей [6]. Известно, что ряд пептидов благотворно влияют на кожу человека и применяются в косметических средствах и продуктах для ухода за кожей. Ацетилдекапептид-3 уменьшает и предотвращает появление морщин, активно генерируя новые клетки кожи. Декапептид-4 применяют для борьбы со старением и заживления ран. Медный трипептид-1 способствует циркуляции крови в коже и стимулирует клетки. Олигопептид-24 минимизирует рубцы путем образования новых клеток кожи. Трипептид-6 увлажняет сухую кожу и поддерживает оптимальный баланс влаги. Тимозин улучшает кровообращение, стимулирует стволовые клетки и оживляет волосяные фолликулы.

 Благодаря вышеперечисленным свойствам, биопептиды – важные компоненты составов для процедур мезолифт, мезоглоу, мезоцеллюлит и мезоволосы и мезоскульптинга (mesolift, mesoglow, mesocellulite, mesohair, mesosculpting). С другой стороны, на сегодняшний день лишь небольшое количество применяемых пептидов были изучены в конических испытаниях на человеке. Далее мы рассмотрим некоторые исследованные пептиды, которые применяются в мезотерапии.

Гексапептид-3

Гексапептид-3 (Argreline Acetate, Acetyl Hexapeptide-3, hexapeptide-84; Ac-EEMQRR-NH2, Ac-Glu-Glu-Met-Gln-Arg-Arg-NH2; CAS 616204-22-9) – компонент составов для процедур Mesoglow и Mesolift для омоложения кожи лица. Это ацетилированный фрагмент мембранного белка SNAP25, аминокислотная последовательность которого блокирует высвобождение ацетилхолина. Ацетилхолин, как известно, является нейромедиатором, необходимым для сокращения мышц, а его блокирование помогает расслабить мышцы и разгладить морщины. Гексапептид-3 является гораздо более слабым блокатором, чем ботулотоксин, и имеет гораздо меньшую продолжительность действия. Состав для мезотерапии включает 0,5 мл раствора с концентрацией 5 мкг/мл гексапептида-3, смешанного с 1 мл 1% нейтрального прокаина. Данный коктейль используется для обработки лба, окологлазничной и глабеллярной области [7]. Протокол лечения рассчитан на четыре недели: первая – гиалуроновая кислота + прокаин, диметилэтанол + прокаин; вторая – гиалуроновая кислота + прокаин, гексапептид-3 + прокаин; на третьей – то же, что и в первую; на четвертой – как во вторую. Лечение продолжают в течение 2–3 месяцев, а затем проводят каждые 3–4 недели в качестве поддерживающей терапии. Препарат вводя с использованием техники инъекций наппаж или пистолетом для мезотерапии.

Трипептид-1 и производные

Трипептид-1 (tripeptide-1; GHK, Gly‑His‑Lys; CAS 49557-75-7) изначально выдели в 1973 году из человеческой плазмы крови, на его ранозаживляющие свойства обратили внимание в 1985 году [8]. Активность GHK близка к ретиноевой кислоте, но нанесенный на кожу пептид не вызывает раздражения. Трипептид-1 оказывает стимулирующее действие на синтез гликозаминогликана и коллагена, благодаря чему разглаживаются морщины и уплотняется эпидермис. Полагают, что GHK влияет на фактор роста TGFβ, который, в свою очередь, стимулирует фибриллогенез. GHK является транспортером ионов меди, которые участвуют в ферментативных реакциях в процессе выработки коллагена и восстановления кожи [9]. GHK даже при в отсутствии ионов меди способствует образованию стволовых клеток и пролиферации фибробластов [10, 11]. Таким образом, трипептид‑1 является как молекулой‑носителем, так сигнальным пептидом.

Незамещенный трипептид‑1 имеет низкую биодоступность и на коже подвергается деградации под действием ферментов. Чтобы избежать этих проблем, его применяют как средство для мезотерапии в виде производных [12].

GHK-Cu (Copper Tripeptide-1, (Gly-His-Lys)2Cu; CAS 89030-95-5) – одна из распространенных форм трипептида‑1. В работе [13] оценили in vitro способность микроигл облегчать доставку GHK-Cu при концентрации 5,8 мМ (2,34 мг/мл) в кожу. Для характеристики и количественной оценки микроконтуров, созданных микроиглами внутри кожи, авторы использовали гистологический анализ и конфокальную лазерную сканирующую микроскопию. Для оценки безопасности доставки GHK-Cu с помощью микроигл задействовали клеточные и свиные модели. Устройство для доставки – 3M™ Microchannel Skin System – пластиковый микроигольчатый пластырь из прямоугольной сетки игл (13×27, или 351 игла). Микроиглы имели квадратную пирамидальную форму с высотой около 700 мкм и расстоянием между кончиками игл 500 мкм. Глубина и процент проникновения микроигл коррелировали с силой нанесения, которая, в свою очередь, влияла на степень увеличения проницаемости кожи для GHK-Cu. Через 9 часов 134±12 наномолей пептида и 705±84 наномолей меди проникли через кожу человека, обработанную микроиглами, в то время как через интактную кожу пептид и медь практически не проникали. При использовании GHK-Cu после предварительной обработки микроигл не наблюдалось явных признаков раздражения кожи. Усиление проницаемости кожи для GHK-Cu с помощью микроигл оказалось эффективным и безопасным. Тест на раздражение in vivo на свиньях показал его отсутствие до концентрации 5,8 мМ (2,34 мг/мл) GHK-Cu.

Клиническое исследование 2019 года длительностью 18 месяцев по применению трипептида‑1 GHK-Cu было направлено на лечение последствий акне [14]. Заживление шрамов от акне изучалось на 24 пациентах, 18–35 лет. GHK-Cu применялся в концентрации 1%.[I1]  Для всех пациентов использовался крем с 1% лигнокаином, который наносился на 45 минут до начала процедуры. Одну группу обрабатывали только дермароллером (иглы размером 1,5 мм), а другую – дермароллером с GHK-Cu. Дермароллером проводили по лицу в горизонтальном, вертикальном и диагональном направлениях 10–15 раз до появления поверхностного точечного кровотечения. Обеим группам было предложено пять сеансов с месячным интервалом между последовательными курсами. Шрамы оценивались с помощью количественной шкалы Гудмана и Барона до вмешательства и на каждом сеансе. Изначально средний балл в группе применения дермароллеров составил 11,42 (n=12), а с пептидом – 12,92 (n=12). В результате после дермароллеров баллы снизились до 8,50 и до 6,50 – в группе с пептидом, что на 26,30% и 50,30% меньше среднего значения, соответственно. Угловатые рубцы после акне уменьшились до 77,78%, холмистые рубцы – до 34,79%, сколотые рубцы не изменились. Дермароллер с GHK-Cu оказался безопасным и эффективным мезотерапевтическим методом лечения.

Пальмитоил трипептид‑1 (Palmitoyl Tripeptide-1 “Matrixyl ™ 3000”, “SpecPed® BT 1P” и “Procapil®“, Pal‑Gly‑His‑Lys, Pal‑GHK CAS 147732-56-7) – это сигнальная молекула, запускающая обновление коллагена, которая широко применяется в средствах с эффектом омоложения для ухода за кожей [15]. Этот модифицированный GHK используется в мезотерапии, однако клинических доказательств его эффективности при таком методе доставки до сих пор не опубликованы.

Пальмитоил тетрапептид-7

Пальмитоил тетрапептид-7 (Palmitoyl Tetrapeptide-7,      N-Palmitoylrigin Rigin™, Matrixyl® 3000, Eyeliss™, Haloxyl™, SpecWhite® Plus, Regestril™, Apep Degine, AC Dark Circle Complex, Corum 8804, Pal-GQPR, Pal-Gly-Gln-Pro-Arg-OH; CAS 221227-05-0) –несущий остаток пальмитиновой кислоты фрагмент иммуноглобулина IgG. Pal‑GQPR обладает противовоспалительным эффектом и понижает секрецию провоспалительного интерлейкина‑6 в базальных кератиноцитах и фибробластах, повышая упругость кожи in vivo [16].

Пальмитоил тетрапептид-7 исследовали in vitro в работе [17] было оценить влияние микроигл на проникновение пептидов в кожу при концентрации 500 мкг/мл и времени воздействия 1 час, используя флуоресцентную визуализацию для определения распределения в коже. Кожа использовалась от разных доноров. Было отмечено улучшение сигнала в 1,7 раза при усиленной доставке Pal-GQPR с помощью микроигл.

Пальмитоил пентапептид-4

Пальмитоил пентапептид‑4 (Palmitoyl pentapeptide‑4; palmitoyl pentapeptide‑3 – до 2006 года, palmitoyl oligopeptide; Matrixyl, Rigin, Matrixyl 3000, Eyeliss™, Haloxyl™, SpecWhite® Plus, Regestril™, Apep Degine, AC Dark Circle Complex, Corum 8804, Pal‑KTTKS, Pal‑Lys‑Thr‑Thr‑Lys‑Ser; CAS 214047-00-4) – сигнальный синтетический пептид, фрагмент проколлагена I, модифицированный введением пальмитоильного остатка для улучшения биодоступности. Пептид может стимулировать образование коллагена типа I, III и VI, глюкозаминогликана, эластина и фибронектина [18]. Незамещенный KTTKS известен с1993 года.

Воздействие KTTKS на синтез коллагена и внеклеточного матрикса преимущественно обусловлено биосинтетическим путем, причем он не является клеточноспецифичным [15]. Pal‑KTTKS эффективен против морщин, пор и возрастных пятен [18]. Pal-KTTKS с концентрацией 0,1 мкM оказывает влияние на процессы заживления раны благодаря действию на фактор роста соединительной ткани и экспрессию α-гладкомышечного актина в первичных фибробластах крайней плоти человека in vitro [19].

Pal‑KTTKS можно вводить с помощью мезотерапевтических методов, что ведет к улучшению доставки пептида, как было показано в эксперименте in vitro при концентрации 500 мкг/мл [17].

Пальмитоил пентапептид‑4 с мезотерапевтической доставкой исследован на человеке в течение 12 недель в двойном слепом плацебо-контролируемом рандомизированном клиническом исследовании [20]. Европеоидные женщины (93 человека, возраст 35–55 лет) получали увлажняющее средство или такое же средство, но содержащее 3 ppm (3 мкг/мл) Pal-KTTKS. На каждую сторону лица наносилось количество приблизительно 0,4 г каждого испытуемого состава дважды в день в течение 12 недель, причем вечернее нанесение происходило не менее чем за 1 час до сна. Pal-KTTKS хорошо переносился кожей и обеспечил значительное улучшение по сравнению с плацебо в отношении уменьшения морщин и мелких линий как при количественном техническом, так и при экспертном анализе изображений. Суммарная длина линий сократилась на 14%, а баллы, выставляемые экспертами, выросли с 0,8 до 1. При самооценке испытуемые также сообщили об улучшении морщин и отметили положительный эффект для других параметров состояния лица.

Тимозин бета-4

Тимозин бета-4 (TB-500, thymosin β4, Timbetasin, Thymosin beta-4; MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES; ТВ-4, RGN-352, RGN-259; CAS 77642-24-1, 7591-33-4), пептидный фактор роста, – небольшая 43-аминокислотная молекула, которая обладает множеством биологических активностей, включая стимулирование клеточной миграции, ангиогенеза, выживания клеток, выработки протеаз и заживления ран.

При использовании в мезотерапии тимозин вводится в мезодерму кожи головы, т. е. непосредственно в волосяные фолликулы [6]. Тимозин вызывает рост волосяных фолликулов, улучшая кровообращение, стимулируя стволовые клетки и оживляя волосяные фолликулы.

В работе [21] обнаружили, что тимозин способствует р[I2] осту волос в различных моделях облысения на крысах и мышах, включая трансгенную мышь, сверхэкспрессирующую тимозин бета-4. При местной обработке раневой поверхности шкур крыс раствором со 100 мкг тимозина в течение семи дней наблюдалось 68,3% активных фолликул, что превосходит 2% миноксидил (56,9%), его смесь с тимозином (62,4%) и необработанный контроль (56,0%). При прекращении использования тимозина бета-4 количество активных волосяных фолликулов снижалось до контрольного уровня за две недели.

Пептидные коктейли в мезотерапии

Коктейль на основе ацетилглутамил октапептида-3 и snap-8

Ацетилглутамил октапептид-3 (Acetyl Glutamyl Octapeptide-3, snap-8™, SpecPed® AO3P, Ac-EEMQRRAD, Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2; CAS 868844-74-0) используют в косметических средствах. Ac-EEMQRRAD применяют в жидком виде или инкапсулированные в макроэлементы, такие как нано-, микрочастицы и микрогубки, которые действуют аналогично с принципом мезотерапии. Этот вариант применения запатентован [22]. Исследователи считают, что snap-8 демонстрирует синергетический эффект на синтез коллагена 1 в комбинации с пептидом серилезин (Serilesine, Hexapeptide-10, SIKVAV, Ser-Ile-Lys-Val-Ala-Val; CAS 146439-94-3). Ингредиенты и их пропорции в водном растворе были таковы: Pal-KVK-OH×2TFA –10 мМ (4%), snap-8™ – 12%, серилезин – 12%, гермабен II – 0,6%. Синтез коллагена увеличивается на 5,9% с 2,1ppm (2,1 мкг/мл) Pal-KV[I3] K-OH×2TFA и на 23,6% с 0,6%-ой композиций, что указывает на синергетический эффект пептидов. Однако остается не ясным, который из трех использованных пептидов был наиболее активным в этой композиции.

Коктейль на основе пальмитоил трипептида-5 и ацетил гексапептида-3

Пальмитоил трипептид-5 (Palmitoyl Tripeptide-5  , SYN®-COLL, TAAA – Triple-Action Anti-Aging, SYN-EYE®, MultiSal™, SYN®-TC, SalSphere® Severe Acne/Anti-Aging Lifting, Pal-KVK, Pal-Lys-Val-Lys-OH; CAS 623172-56-5) изучен в двойном слепом, рандомизированном, проспективном исследовании по лечению одно- или двусторонних хирургических рубцов возрастом 1–18 месяцев [23]. Хирургические рубцы были рандомизированы в группу контроля или для лечения с помощью губки с гиалуроновой кислотой, пептидом и витамином С; обе группы применяли микророллеры (нержавеющая сталь, 0,25 микрон). За участниками наблюдали через 4 недели, 12 недель и 1 год. В исследовании приняли участие 23 пациента, шесть выбыли, в окончательный анализ включены 17 (средний возраст 43,5). Средний балл по визуальной аналоговой шкале для рубцов, получавших губку с лекарством, был немного ниже, чем для рубцов, обработанных плацебо, но разница не была статистически значимой. Лекарственное средство включало витамин С, воду, систему HylaSponge, аскорбилфосфат магния, ацетил гексапептид-3, глицерин, лимонную кислоту, пальмитоил трипептид-5, гидролизованный протеин жожоба, бензиловый спирт/уксусную кислоту, алоэ, ксантановую камедь, натриевую соль этилендиаминтетрауксусной кислоты и ароматическое масло. Несмотря на незначительные изменения, по результатам опроса, удовлетворенность пациентов губкой с активными компонентами была высокой.

Эффективность биоактивных пептидов, нанесенных на микроигольчатые пластыри с гиалуроновой кислотой оценили в клиническом испытании, где приняли участие 20 здоровых европеоидных женщин в возрасте от 40 до 71 года [24]. Целью данного исследования была оценка переносимости и эффективности микроигольчатых пластырей с биоактивными веществами для восстановления свойств кожи, включая увлажнение, сокращение морщин, плотность и толщину. Тестируемый продукт HA-MNs включая полипептид аргинин/лизин, ацетил октапептид-3, пальмитоил трипептид-5, аденозин и экстракты морских водорослей. Пластыри HA-MNs накладывались на внешний угол правого и левого глаза и определенную область на волярном предплечье здоровых людей с возрастной кожей. Затем был проведен инструментальный анализ свойств кожи. Продукт отлично переносился; никто из испытуемых не сообщил о каких-либо первичных или кумулятивных кожных реакциях. Оценка измеряемых свойств кожи дает представление об общей эффективности: мелкие морщинки уменьшились на 25,8%, увлажненность кожи улучшилась на 15,4%, плотность и толщина кожи в дерме увеличились на 14,2% и 12,9% соответственно (Рис. 2). Таким образом, состав патчей с микроиглами действует многоцелевым образом, и все ингредиенты могут работать синергетически для улучшения структуры, функций и внешнего вида кожи.

Рисунок 2 – Улучшение состояния рубца через 12 недель.

Коктейль декапептида-4, ацетил декапептида и трипептида меди

Раствор Mesohair содержащий 56 ингредиентов, включая 24 аминокислоты, 13 витаминов, 4 кофермента, 4 нуклеиновые кислоты, 5 минералов, 2 восстановителя и ативные пептидные ингредиенты – декапептид-4 (Decapeptide-4, CG-IDP2[I4] ), ацетил декапептид и трипептид меди, изучили на 65 мужчина в возрасте 18–35 лет с клинически диагностированной андрогенной алопецией легкой и средней степени тяжести [25]. Из них, 49 мужчин были случайным образом распределены на группу для получения сочетания мезораствора и миноксидила (n = 25) и группу (n = 24), где применялся только миноксидил. Процедура повторялась еженедельно в течение месяца, затем раз в две недели – два месяца и ежемесячно – еще два месяца. Таким образом, всего было проведено восемь сеансов. Пациентам, получавшим миноксидил, было назначено нанесение 2–3 мл 5% раствора миноксидила дважды в день на облысевшие участки кожи головы. Изменение диаметра стержня волоса в группе мезотерапии на 7% превышал таковой для миноксидила через четыре месяца. Общее количество волос было одинаковым через два месяца, а плотность была незначительно меньше после Mesohair. Остальные показатели оказались близки между группами.

Коктейль с факторами роста и медным трипептидом-1

Мезококтейль, содержащий эндотелиальный фактор роста сосудов (human oligopeptide-11, VEGF), тимозин бета-4, инсулиноподобный фактор роста (IGF-1), основной фактор роста фибробластов (bFGF), фактор роста кератиноцитов (KGF, FGF7[I5] ) и медный трипептид-1 (GHK-Cu), был изучен в открытом пилотном клиническом исследовании 2018 года, где оценивали безопасность и эффективность этой смеси для стимуляции роста волос при интрадермальном инъекционном введении [31].

В исследовании участвовала 1 тыс. пациентов в возрасте 20–60 лет с диагностированным облысением по мужскому или женскому типу. Условием включения было отсутствие реакции не менее года на местное нанесение миноксидила, 2% – для женщин и 5% – для мужчин, и прием финастерида (1 мг перорально для мужчин). Предварительно на мышах были изучены четыре водных раствора с различными концентрациями компонентов (мг/л): 1) VEGF 0,01, bFGF 0,01, IGF-1 0,01, GHK-Cu 0,01, KGF 0,01, ТВ-4 0,005; 2) VEGF 2, bFGF 1, IGF-1 1, GHK-Cu 5, KGF 0,5, ТВ-4 0,001; 3) VEGF 5, bFGF 2, IGF-1 2, GHK-Cu 10, KGF 1, ТВ-4 0,01; 4) VEGF 15, bFGF 5, IGF-1 5, GHK-Cu 30, KGF 2, ТВ-4 0,1 [31]. Наиболее эффективным оказался раствор 3 при введении по 0,1 мл/мышь, вызвавший рост волос у 100% животных на десятый день, с максимальным эффектом через месяц. Увеличение концентрации ингредиентов сверх той, что была в растворе 4, не дало существенного преимущества с точки зрения количества растущих волос у мышей или диаметра области роста волос.

Состав для волос 3, показавший наилучшие результаты и названный авторами «QR 678» (от “Quick Response” – быстрый отклик), не оказал побочных эффектов на животных, и затем был использован в испытаниях на людях [31]. В раствор также были введены дополнительные полезные компоненты. Предпочитаемый состав «QR 678» следующий (мг/л): VEGF 0,01–100, bFGF 0,01–100, IGF-1 0,01–100, GHK-Cu 0,1–500, KGF 0,01–100, ТВ-4 0,05–100; витамины А, В1, В2, В3, В5, В6, В7, B12, C, E, I, K; минералы кальций, натрий, калий, магний; заменимые и незаменимые аминокислоты.

Множественные, небольшие и практически безболезненные внутрикожные инъекции раствора вводились в кожу головы. Инъекции делались с помощью инсулинового шприца с иглой 31G во всех областях видимого поредения волос и алопеции. В общей сложности 1,5 мл раствора вводилось за один сеанс методом наппажной техники в пораженные участки, один раз в 3 недели, всего 8 таких сеансов. За сеанс в кожу головы в местах поредения волос приходилось приблизительно 60–70 инъекций, внутрикожно методом наложения, каждая инъекция на расстоянии 1 см друг от друга, общий объем одной инъекции составлял 0,02 мл [31].

В результате у 83% добровольцев было обнаружено значительное подавление выпадения волос в повторенном трижды тесте на выдергивание: количество плохо держащихся волос снизилось с 10 до 3 к пятому сеансу. У 75% пациентов начался рост новых волос (Рис. 3) [31]. Через восемь сеансов количество терминальных волос возросло с 64,14 до 78,71 в диаметре 15 см и с 82,14 до 90,29 – 20 см. Средний диаметр волоса возрос с 27,29–29,98 мкм до 30,98–32,77 мкм на той же площади. Состав «QR 678» оказался эффективным и безопасным – только 15% участников сообщали о небольшом зуде, а боль во время инъекций легко переносилась. Достигнутый эффект сохранялся через год после окончания лечения.

Рисунок 3 – Результаты лечения мужчины (верх) и женщины (низ) через восемь сеансов

Коммерчески доступные мезококтейли, содержащие пептиды

Доступны следующие мезопродукты для мезолифтинга и ревитализации [32]:

1. Mesoface (Worlddermic, Испания) – от 30 до 100 мг натриевой соли гиалуроновой кислоты 5% маннитола, диметиламиноэтанол, пептид проколлагена, аргирелин, лейфазил, морской коллаген, кремний, витамины B1–B6.

2. Medi Derma (Sesderma Laboratories, Испания) – Mesocit TGF β2/EGF-TGF β2/EGF с низкомолекулярной гиалуроновой кислотой, цинком и аминокислотами, медью, пантенолом, капроилтетрапептидом-3, органическим кремнием, витамином С.

Доступные составы для мезококтейлей для роста волос:

1. MesoHair – пантенол, лейфазил, экстракты Algisium C. и Gotu kola.

3. Hair Revival (Inno TDS, Innoaesthetics, Испания) ­­– аминофиллин, глутатион, хондроитин сульфат, АТФ, пептиды, факторы роста волос, аденозин, цинк, пиридоксин

4. Pluryal Hair (PluryalMesoline, Люксембург) – кофеин, пептиды меди, стволовые клетки растений, витамины группы В, аминокислоты, гиалуроновая кислота.

Приведенный список не является исчерпывающим, поскольку на рынке регулярно появляются новые продукты для мезотерапии.

Дополнительные компоненты мезокотейлей

Биоомоложение

Биоомоложение (мезолифт, мезоглоу) – это термин, используемый для мезотерапевтического омоложения кожи лица и шеи. Агенты, обычно используемые для мезолифтинга, – это гиалуроновая кислота, гликозаминогликан, который связывает и удерживает воду, улучшая тем самым тонус и эластичность кожи [5, 7]. Гиалуроновая кислота, используемая в мезотерапии, не сшита (так как ее основная функция – увлажнение) в отличие от филлеров, где, наоборот, сшита (функция – заполнить лакуну). Мультивитамины, микроэлементы регулируют ионный баланс кожи. Аминокислоты, растительные белки способствуют восстановлению белка. Диметиламиноэтанол, предшественник фосфатидилхолина, преобразует холин в ацетилхолин и таким образом вызывает сокращение мышц, что приводит к улучшению упругости (в основном подходит для нижней части лица).

В последнее время после мезолифтинга на лице используются листы натурального сублимированного коллагена. Коллагеновые листы принимают форму той части лица, на которую они наложены, и, благодаря своей влагоудерживающей способности, увлажняют кожу и делают ее более упругой. Ультразвуковое исследование кожи используется для оценки так называемой субэпидермальной полосы низкой эхогенности (SLEB), расположенной непосредственно под эпидермальным входом эха, как маркера фотостарения [33]. Было замечено, что при мезотерапии наблюдается улучшение SLEB. Это можно объяснить увлажняющим эффектом гиалуроновой кислоты в тканях, благодаря ее способности поглощать воду во много раз больше своего веса. Кроме того, повторные инъекции в дерму также могут запустить процесс заживления, активизируя фибробласты, вырабатывающие больше коллагена.

Составы для мезоглоу в основном в качестве основных ингредиентов содержат глутатион, аскорбиновую кислоту, а также койевую, гликолевую, пировиноградную, азелаиновую кислоту и растительные экстракты для осветления и уменьшения поверхностных пигментных аномалий. Процедура из 4–6 сеансов обычно повторяется с интервалом в одну или две недели. Для достижения оптимального результата мезоглоу следует сочетать с медицинским лечением осветляющими средствами и/или чередовать сеансы мезотерапии и поверхностного или средней глубины химического пилинга.

Мезоботокс или микроботокс подразумевает введение ботулотоксина в дерму для достижения наилучшего результата. Количество или разведение ботулотоксина имеет решающее значение, так как слишком малое приведет к неадекватным результатам и недовольству пациента, а большое – к тому, что средство будет доставлено в неправильной плоскости, что приведет к нежелательным последствиям. Микроботокс воздействует на поверхностный слой лицевых мышц, которые прикреплены к нижней поверхности дермы, сохраняя функцию более глубоких мышечных волокон и придавая естественный вид. Тонкие линии и морщины уменьшаются за счет ослабления лицевых мышц, а не полного их паралича. Более того, микроботокс вызывает объемную атрофию потовых и сальных желез, тем самым улучшая текстуру кожи и придавая ей блеск. В последнее время мезоботокс также используется для расслабления мышечных волокон кожи головы, что приводит к расширению кровеносных сосудов в области головы, способствуя лучшему снабжению волосяных фолликулов питательными веществами. Микроботокс особенно эффективен при лечении ритидов шеи и нижней части лица, а такж может применяться по следующим показаниям: динамические морщины лба, глабеллярные линии, латеральные кантальные линии, нижняя часть лица, линии шеи (платизматические полосы), открытые поры, акне и рубцы от акне, келоиды, гипергидроз, выпадение волос Существуют различные способы приготовления растворов для микроботокса, что может зависеть от предпочтений специалиста по мезотерапии и обрабатываемой области. Обычно применяют 100 единиц онаботулинового токсина типа А с 10 мл нормального физраствора (10 ЕД ботокса на 1 мл) или более концентрированные, до четырех раз, растворы (до 24 ЕД /мл).

Техника инъекции требует использования иглы 30 или 32 G, со скосом, направленным вниз и параллельно коже, создавая небольшое матовое пятно. 0,05 мл или 2 ЕД в виде многочисленных маленьких капель (10–20 шт.) или 0,01 мл раствора следует вводить в каждую точку с интервалом 0,8–1,0 см в дерму или на границу между дермой и поверхностью лицевых мышц в виде сетки. Шприц с замком Луера работает лучше, так как стандартный инсулиновый шприц (31G) приводит к частой утрате раствора. Продолжительность эффекта от микроботокса обычно длится от 1 до 3 месяцев.

В ряде случаев ботулотоксин можно заменить, как отмечено выше, менее токсичными пептидами – гексапептидом-3 и другими, которые оказывают тонизирующий эффект на кожу, например, пептиды вилочковой или шишковидной железы.

Алопеция

Существует мало исследований, проливающих свет на роль мезотерапии в лечении алопеции. В работе [34] было показано, что мезотерапия препаратом, содержащим дутастерид, оказалась значительно эффективнее при выпадении волос по женскому типу, чем физраствор после 16 недель лечения, что подтвердилось с помощью четырех методов оценки: фотографической, теста на выдергивание волос, измерения диаметра волос и самооценки пациента. Однако существует несколько сообщений, где алопеция развилась как побочный эффект после применения мезотерапии при облысении [35]. У двух пациентов после мезотерапии с гепариновым сосудорасширяющим мезогликаном и у одного – после гомеопатических средств [36]. В качестве осложнений мезотерапии головы сообщалось о мультифокальном абсцессе кожи головы с некрозом подкожного жира и рубцовой алопеции [37]. Несмотря на отсутствие контролируемых опубликованных исследований эффективности мезотерапии при заболеваниях волос, инъекции миноксидила, финастерида, лидокаина и поливитаминов используются при лечении алопеции.

Целлюлит

Целлюлит – это аномальное скопление жира над фасциями, в результате чего на коже появляются ямочки, напоминающие апельсиновую корку. Оно встречается как у людей с ожирением, так и нормальным телосложением. Считается, что целлюлит возникает из-за нарушений в венозно-лимфатической системе, поэтому коктейль для лечения должен содержать соответствующие вещества [5]. Липолитическими свойствами обладают L-карнитин, кофеин, изопротеренол, тироксин; веностатическими – рутин, аминофиллин, пентоксифиллин. Дренажные эффекты оказывают артишок, гиалуроновая кислота, гинкго билоба. В смесь вводят анестетики, например, прокаин, который также улучшает кровообращение. Разрушение соединительной ткани производят коллагеназа и гиалуронидаза. Однако мезотерапия будет эффективна только в сочетании с правильным питанием и физическими упражнениями. В последнее время в составе инъекционных коктейлей используются гормоны щитовидной железы, чтобы вызвать уменьшение жировой ткани [38]. Они активируют симпатическую систему и таким образом вызывают липолиз, активируя бета-рецепторы. Фосфатидилхолин и дезоксихолат являются наиболее широко используемыми агентами для жирорастворения. Фосфатидилхолин – это антиоксидант, получаемый из соевого лецитина. Глубина инъекции варьируется от 6 мм до 12 мм при дозе 250 мг [39]. Однако фосфатидилхолин не может использоваться для лечения поверхностного целлюлита. Фосфатидилхолин, полученный из соевого лецитина, проникает в адипоциты и расщепляет жир, который затем попадает в кровоток и выводится через почки и кишечник. Фосфатидилхолин вязкий, поэтому для облегчения его введения добавляется эмульгатор – дезоксихолат, который, как показано, самостоятельно вызывает лизис адипоцитов [40]. Используются и другие вещества: липолитические – дезоксихолат (желчная соль), L-карнитин (также вызывает окисление жирных кислот), аминофиллин, кофеин, ксантин и органический кремний (также ингибирует образование свободных радикалов, восстанавливает эластин и коллаген). Разрушение соединительной ткани: гиалуронидаза, коллагеназа. Усилители дренажа: артишок. Усилители кровообращения: йохимбин (2-адренергический блокатор), аминофиллин, пентоксифиллин. Витамин А и микроэлементы важны для регулирования оборота, кератинизации и восстановления кератиноцитов; витамин С усиливает синтез коллагена и уменьшает гиперпигментацию, так как подавляет выработку меланина; витамин Е, антиоксидант, помогает в борьбе со старением кожи; витамин К влияет на механизмы свертывания крови и таким образом регулирует микроциркуляцию кожи.

Противопоказания к мезотерапии

1. Фосфатидилхолин – нет специфических противопоказаний, с осторожностью использовать при синдроме антифосфолипидных антител.

2. Аминофиллин – история повышенной чувствительности к препарату, активная пептическая язва, судорожные расстройства.

3. L-карнитин – с осторожностью применять у пациентов с судорожными расстройствами.

4. Гиалуроновая кислота – известная повышенная чувствительность к препарату, использование других четвертичных аммониевых соединений, так как они осаждают гиалуроновую кислоту.

5. Пентоксифиллин, аминофиллин – недавние церебральные и ретинальные кровоизлияния.

6. Маннитол – почечные заболевания, отек легких.

7. Кофеин – гипотензия, желудочковая тахикардия, тревожность, побочные эффекты со стороны желудочно-кишечного тракта.

8. Общие – возраст <18 лет, сахарный диабет, индекс массы тела >30, беременность, лактация.

9. Тяжелые сердечные, почечные заболевания, тромбоэмболические явления.

10. Непереносимость других компонентов или аллергия.

Непрофессиональное и небрежное использование в мезотерапии таких препаратов, как аминофиллин, прокаин, изопротеренол, является серьезной проблемой.

Побочные эффекты

В отличие от утверждений о том, что мезотерапия является безопасной, минимально инвазивной процедурой, сообщалось о различных нежелательных последствиях. К неспецифическим побочным эффектам относятся тошнота, рвота, легкая боль, гиперестезия кожи, отек, зуд и эритема [6]. Из-за неправильной техники возникают атипичные микобактериальные инфекции (Mycobacterium fortuitum), язвы и рубцы, узловатость и неравномерность. Другие побочные эффекты: атрофия, липодистрофия, подкожные олеомы из-за инъекций минерального или кунжутного масла как такового или использования масла даже в качестве транспортного средства для витамина B12 или фосфатидилхолина, лихеноидные высыпания, поствоспалительная гиперпигментация и редкие осложнения, такие как кебнеризация при псориазе, локализованная пигментная крапивница, гранулема аннуларе, неинфекционный гранулематозный панникулит и инфекция Mycobacterium abscessus. Возможности лечения осложнений ограничены. При мезотерапевтическом панникулите, являющемся одним из потенциальных последствий этой процедуры, может быть эффективен дапсон. Местные и пероральные стероиды и колхицин с некоторым успехом опробованы в лечении олеомы [41]. Однако полное хирургическое иссечение остается методом выбора для предотвращения рецидива.

Реакции гиперчувствительности, инфекции, такие как ВИЧ, гепатит и нетуберкулезные микобактерии (Mycobacterium immunogenum), повышение уровня печеночных ферментов с печеночной токсичностью или без нее и демиелинизация нервов из-за больших доз фосфатидилхолина могут возникать при неправильно проведенной мезотерапии. Ишемический колит из-за комбинированного сосудосуживающего эффекта возникал у пациентов, получавших мезотерапию и препараты против ожирения.

Заключение

В последние годы мезотерапия приобрела популярность благодаря своей неинвазивности и безболезненности, однако до сих пор принцип действия многих используемых препаратов неизвестен, и отсутствуют четкие рекомендаций по дозировке и эффективности. Также нет достаточного количества данных, оценивающих безопасность метода и используемых средств. Несмотря на то, что мезотерапия существует уже почти 70 лет и привлекает много внимания, но утверждения производителей составов и специалистов по косметологии не всегда основаны на хорошо проведенных клинических испытаниях.

Для обоснования эффективности новых продуктов и методик, а также для выработки руководящих принципов и рекомендаций по их использованию в эстетических целях, необходимы дополнительные и хорошо спланированные контролируемые научные исследования.


1.         Atlas of Mesotherapy in Skin Rejuvenation. 2007, London: Informa Healthcare. p. 130.

2.         Textbook of cosmetic dermatology. 4 ed, ed. D.J. Goldberg, Lowe, N.J., Lask, G.P. 2010, London: Informa Healthcare. p. 574.

3.         Oh, D., Reverse-Aging Biotechnology. 2018, Regeron, Inc: South Korea.

4.         Sivagnanam, G., Mesotherapy – The french connection. Journal of pharmacology &amp; pharmacotherapeutics, 2010. 1(1): p. 4-8. DOI: 10.4103/0976-500x.64529.

5.         Sarkar, R., Garg, V.K., Mysore, V., Position paper on mesotherapy. Indian journal of dermatology, venereology and leprology, 2011. 77(2): p. 232-237. DOI: 10.4103/0378-6323.77479.

6.         Konda, D., Thappa, D.M., Mesotherapy: What is new? Indian journal of dermatology, venereology and leprology, 2013. 79(1): p. 127-134. DOI: 10.4103/0378-6323.104689.

7.         Frisari, P., Mesoglow, P.R. Mesolift to rejuvenate facial skin. Ammerican Journal of Mesotherapy [cited 5. Available from: https://www.soarme.com/archivos/1323869416.pdf.

8.         Gorouhi, F., Maibach, H.I., Role of topical peptides in preventing or treating aged skin. International journal of Cosmetic Science, 2009. 31(5): p. 327-345. DOI: 10.1111/j.1468-2494.2009.00490.x.

9.         Reddy, B.Y., Jow, T., Hantash, B.M., Bioactive oligopeptides in dermatology: Part II. Experimental Dermatology, 2012. 21(8): p. 569-575. DOI: 10.1111/j.1600-0625.2012.01527.x.

10.       Choi, H.R., Kang, Y.A., Ryoo, S.J., Shin, J.W., Na, J.I., Huh, C.H., Park, K.C., Stem cell recovering effect of copper‐free GHK in skin. Journal of Peptide Science, 2012. 18(11): p. 685-690. DOI: 10.1002/psc.2455.

11.       Gruchlik, A., Chodurek, E., Dzierzewicz, Z., Influence of selected peptides and their copper complexes on antioxidant enzyme activities in human skin fibroblasts. Postepy Dermatologii i Alergologii, 2010. 27(1): p. 29.

12.       Cho Lee, A.-R., Microneedle-mediated delivery of cosmeceutically relevant nucleoside and peptides in human skin: challenges and strategies for dermal delivery. Journal of Pharmaceutical Investigation, 2019. DOI: 10.1007/s40005-019-00438-y.

13.       Li, H., Low, Y.S.J., Chong, H.P., Zin, M.T., Lee, C.-Y., Li, B., Leolukman, M., Kang, L.J.P.r., Microneedle-mediated delivery of copper peptide through skin. 2015. 32(8): p. 2678-2689. DOI: 10.1007/s11095-015-1652-z.

14.       Kumar, P., Copper Peptides in Acne Scars. Journal of Medical Science And clinical Research, 2019. 7(2): p. 63–74. DOI: 10.18535/jmscr/v7i2.15.

15.       Schagen, S., Topical Peptide Treatments with Effective Anti-Aging Results. Cosmetics, 2017. 4(2). DOI: 10.3390/cosmetics4020016.

16.       Cosmetic Dermatology Products and Procedures. 2 ed. 2016, New Delhi, India: John Wiley & Sons. p. 563.

17.       Mohammed, Y.H., Yamada, M., Lin, L.L., Grice, J.E., Roberts, M.S., Raphael, A.P., Benson, H.A.E., Prow, T.W., Microneedle Enhanced Delivery of Cosmeceutically Relevant Peptides in Human Skin. PLOS ONE, 2014. 9(7): p. e101956. DOI: 10.1371/journal.pone.0101956.

18.       Cosmeceuticals and Active Cosmetics. 3 ed. 2015, Boca Raton, U.S.: CRC Press Taylor & Francis Group. p. 437.

19.       Park, H., An, E., Cho Lee, A.-R., Effect of Palmitoyl-Pentapeptide (Pal-KTTKS) on Wound Contractile Process in Relation with Connective Tissue Growth Factor and α-Smooth Muscle Actin Expression. Tissue Engineering Regenerative Medicine, 2017. 14(1): p. 73-80. DOI: 10.1007/s13770-016-0017-y.

20.       Robinson, L.R., Fitzgerald, N.C., Doughty, D.G., Dawes, N.C., Berge, C.A., Bissett, D.L., Topical palmitoyl pentapeptide provides improvement in photoaged human facial skin1. International Journal of Cosmetic Science, 2005. 27(3): p. 155-160. DOI: 10.1111/j.1467-2494.2005.00261.x.

21.       Philp, D., St-Surin, S., Cha, H.-J., Moon, H.-S., Kleinman, H.K., Elkin, M., Thymosin Beta 4 Induces Hair Growth via Stem Cell Migration and Differentiation. Annals of the New York Academy of Sciences, 2007. 1112(1): p. 95-103. DOI: 10.1196/annals.1415.009.

22.       US 8865651 B2, 2014.

23.       Amirlak, B., Mahedia, M., Shah, N., A Clinical Evaluation of Efficacy and Safety of Hyaluronan Sponge with Vitamin C Versus Placebo for Scar Reduction. Plastic and reconstructive surgery. Global open, 2016. 4(7): p. e792-e792. DOI: 10.1097/GOX.0000000000000734.

24.       Avcil, M., Akman, G., Klokkers, J., Jeong, D., Çelik, A., Efficacy of bioactive peptides loaded on hyaluronic acid microneedle patches: A monocentric clinical study. J Cosmet Dermatol.. 0(0). DOI: 10.1111/jocd.13009.

25.       Gajjar, P.C., Mehta, H.H., Barvaliya, M., Sonagra, B., Comparative Study between Mesotherapy and Topical 5% Minoxidil by Dermoscopic Evaluation for Androgenic Alopecia in Male: A Randomized Controlled Trial. International journal of trichology, 2019. 11(2): p. 58-67. DOI: 10.4103/ijt.ijt_89_18.

26.       Goldstein, A.L., Badamchian, M., Thymosins: chemistry and biological properties in health and disease. Expert Opinion on Biological Therapy, 2004. 4(4): p. 559-573. DOI: 10.1517/14712598.4.4.559.

27.       Дьяконов, М.М., Черкашин, В.А., Нелюбов, М.В. Използване на пептидните биорегулатори—цитамини в кардиологията. 2001; Available from: http://kabomed.com/media/wysiwyg/klinichni-izsledvaniya-citamini/Klinicheski-izsledvaniya-v-kardiologiyata.pdf.

28.       Гома, С.Е., Полипептиды и нуклеиновые кислоты в коррекции возрастных изменений кожи Дисс. канд. мед. наук. 2018 Северо-Западный Государственный медицинский университет имени И. И. Мечникова: Санкт-Петербург. p. 193.

29.       Anisimov, V.N., Khavinson, V.K., Morozov, V.G., Twenty Years of Study on Effects of Pineal Peptide Preparation: Epithalamin in Experimental Gerontology and Oncology. Annals of the New York Academy of Sciences, 1994. 719(1): p. 483-493. DOI: 10.1111/j.1749-6632.1994.tb56853.x.

30.       Yelamanchi, S.D., Kumar, M., Madugundu, A.K., Gopalakrishnan, L., Dey, G., Chavan, S., Sathe, G., Mathur, P.P., Gowda, H., Mahadevan, A., Shankar, S.K., Prasad, T.S.K., Characterization of human pineal gland proteome. Molecular BioSystems, 2016. 12(12): p. 3622-3632. DOI: 10.1039/C6MB00507A.

31.       Kapoor, R., Shome, D., Intradermal injections of a hair growth factor formulation for enhancement of human hair regrowth – safety and efficacy evaluation in a first-in-man pilot clinical study. Journal of Cosmetic and Laser Therapy, 2018. 20(6): p. 369-379. DOI: 10.1080/14764172.2018.1439965.

32.       Kandhari, R., Kaur, I., Sharma, D., Mesococktails and mesoproducts in aesthetic dermatology. Dermatologic Therapy, 2020. 33(6): p. e14218. DOI: https://doi.org/10.1111/dth.14218.

33.       Lacarrubba, F., Tedeschi, A., Nardone, B., Micali, G., Mesotherapy for skin rejuvenation: assessment of the subepidermal low-echogenic band by ultrasound evaluation with cross-sectional B-mode scanning. Dermatologic Therapy, 2008. 21(s3): p. S1-S5. DOI: https://doi.org/10.1111/j.1529-8019.2008.00234.x.

34.       Moftah, N., Moftah, N., Abd-Elaziz, G., Ahmed, N., Hamed, Y., Ghannam, B., Ibrahim, M., Mesotherapy using dutasteride-containing preparation in treatment of female pattern hair loss: photographic, morphometric and ultrustructural evaluation. Journal of the European Academy of Dermatology and Venereology, 2013. 27(6): p. 686-693. DOI: https://doi.org/10.1111/j.1468-3083.2012.04535.x.

35.       Mysore, V., Mesotherapy in Management of Hairloss – Is it of Any Use? International journal of trichology, 2010. 2(1): p. 45-46. DOI: 10.4103/0974-7753.66914.

36.       Duque-Estrada, B., Vincenzi, C., Misciali, C., Tosti, A., Alopecia secondary to mesotherapy. Journal of the American Academy of Dermatology, 2009. 61(4): p. 707-709. DOI: https://doi.org/10.1016/j.jaad.2008.11.896.

37.       Kadry, R., Hamadah, I., Al-Issa, A., Field, L., Alrabiah, F., Multifocal scalp abscess with subcutaneous fat necrosis and scarring alopecia as a complication of scalp mesotherapy. Journal of drugs in dermatology : JDD, 2008. 7(1): p. 72-73.

38.       Marrif, H.I. Thyroid hormones and mesotherapy. Frontiers in endocrinology, 2011. 2, 5 DOI: 10.3389/fendo.2011.00005.

39.       Gillette, B., Mesotherapy: Valuable, versatile treatment option. Dermatol Times, 2006: p. 54-61.

40.       Rotunda, A.M., Suzuki, H., Moy, R.L., Kolodney, M.S., Detergent Effects of Sodium Deoxycholate Are a Major Feature of an Injectable Phosphatidylcholine Formulation Used for Localized Fat Dissolution. Dermatologic Surgery, 2004. 30(7): p. 1001-1008. DOI: https://doi.org/10.1111/j.1524-4725.2004.30305.x.

41.       Ramos-e-Silva, M., Pereira, A.L.C., Ramos-e-Silva, S., Piñeiro-Maceira, J., Oleoma: rare complication of mesotherapy for cellulite. International Journal of Dermatology, 2012. 51(2): p. 162-167. DOI: https://doi.org/10.1111/j.1365-4632.2011.04931.x.


 [I1]

 [I2]Научных и патентных публикаций по тимозину в мезотерапии практически нет. Пруф: https://scholar.google.ru/scholar?hl=ru&as_sdt=2007&q=+Thymosin+mesotherapy&btnG=

2 релевантных результата – один обзор, где упоминается возможность применения, и статья, которой здесь привел – без мезотерапии.

 [I3]По деталям ссылаются на абстракт конференции. Но текст сборника недоступен.

 [I4]CAS нет, структуры нет, в https://ec.europa.eu/growth/tools-databases/cosing/pdf/COSING_Ingredients-Fragrance%20Inventory_v2.pdf перечислены аминокислотные остатки (Decapeptide-4 is a synthetic peptide consisting of arginine, aspartic acid, cysteine, glutamic acid, leucine, methionine and tyrosine). Больше нигде формула не раскрыта.

 [I5]Для него и для VEGF неизвестно, какие именно изоформы применялись.