Коронавирус и пептиды

Белки тутового шелкопряда
27.01.2020
Стабильность пептидов. Хранение
04.02.2020

Пептиды – потенциальное средство против коронавирусов 2019-nCoV, SARS и MERS-CoV

В настоящее время новостные ленты информационных агентств всего мира пестрят сообщениям об эпидемии коронавируса, вспыхнувшей в Китайской Народной Республике и уже охватывающей другие, особенно близлежащие, страны. Общее число заразившихся коронавирусом 2019-nCoV достигает 4,5 тыс. человек, количество смертельных случаев превысило 80­–100 [1, 2].

Агентство Bloomberg привело списки погибших от вируса с указанием симптомов, пола, возраста на 23 января 2020 г [3]. Преимущественно, летальный исход наблюдается у пожилых мужчин старше 60 лет. Наиболее частые симптомы – лихорадка, кашель и затрудненное дыхание. Развитие заболевания может привести к прогрессирующей дыхательной недостаточности из-за повреждения альвеол и даже смерти. Клинические врачи определяли заболевание как вирусно-индуцированную пневмонию в соответствии с клиническими симптомами и другими критериями, включая повышение температуры тела, снижение лимфоцитов и лейкоцитов, новые легочные инфильтраты при рентгенографии грудной клетки и отсутствие очевидного улучшения при лечении антибиотиками в течение трех дней.

Вирус стремительно распространяется по миру. На 28 января 2020 года подтвержденные случаи заражения по странам [2] (по ссылке находится постоянно обновляемая интерактивная карта с новыми случаями заражений и смертей, возможны сбои из-за большой нагрузки): Материковый Китай – 4409, Гонконг – 8, Таиланд – 8, Макао – 6, Австралия – 5, Тайвань – 5, США – 5, Япония – 4, Малайзия – 4, Сингапур – 5, Южная Корея – 4, Франция – 3, Германия – 1, Вьетнам – 2, Камбоджа – 1, Канада – 1, Непал – 1, Шри-Ланка – 1. В России пока не выявлено ни одного подтвержденного случая заражения. Скорость роста числа зараженных на территории материкового Китая соответствует экспоненциальной зависимости. В Китае проводятся карантинные мероприятия, введен запрет на поездки в некоторые пострадавшие районы, по сути, изолировав миллионы людей [3]. Всемирная организация здравоохранения в четверг заявила, что вспышка еще не стала глобальной чрезвычайной ситуацией, но ВОЗ внимательно следит за ситуацией.

 Инфекционным агентом является вирус 2019-nCoV (Wuhan coronavirus, Wuhan seafood market pneumonia virus) – новый штамм коронавируса, выявленный в декабре 2019 года во время вспышки пневмонии в Ухане (Wuhan, КНР) [4]. 2019-nCoV способен передаваться от человека к человеку. Пока не ясно, насколько легко это происходит, но обычно человеческие коронавирусы распространяются по воздуху при кашле и чихании. Инкубационный период составляет до 14 дней, в течение которого также возможно заражение от человека к человеку. В середине января геном вируса 2019-nCoV уже был расшифрован и внесен в базу данных [5]. 2019-nCoV представляет собой одноцепочечный РНК-содержащий вирус, РНК-последовательность которого состоит из 29903 нуклеотидов. Из-за сообщений о том, что первоначальные случаи имели эпидемиологические связи с крупным рынком морепродуктов и животных, считается, что вирус имеет зоонозное происхождение, хотя это не было подтверждено. Сравнение генетических последовательностей между этим вирусом и другими существующими образцами вируса показало 79,5 %-ное сходство с SARS-CoV и 96 %-ное с коронавирусом летучих мышей (BatCoV RaTG13, ранее обнаруженный у азиатского подковоноса, Rhinolophus affinis) [6], с вероятным происхождением от летучих мышей. Название SARS-CoV (severe acute respiratory syndrome-related coronavirus) расшифровывается как «коронавирус, относящийся к тяжёлому острому респираторному синдрому». Уже установлено, что новый вирус 2019-nCoV использует тот же рецептор проникновения в клетку, ACE2, что и SARS-CoV [6].

В целом, коронавирусы (СoV) – это группа вирусов, вызывающих заболевания у млекопитающих и птиц. У людей СoV вызывают респираторные инфекции, которые обычно являются легкими, но в редких случаях могут быть смертельными. У коров и свиней они могут вызывать диарею, а у цыплят – заболевание верхних дыхательных путей. К настоящему времени еще нет ни вакцин, ни противовирусных препаратов, которые были бы одобрены для профилактики или лечения заболеваний, вызванных СoV. По классификации, коронавирусы являются вирусами подсемейства Orthocoronavirinae в семействе Coronaviridae, отряда Nidovirales. Коронавирусы представляют собой оболочечные вирусы с положительно-полярным одноцепочечным РНК-геномом ((+)ssRNA) и с нуклеокапсидом спиральной симметрии. Размер генома СoV составляет примерно от 26 до 32 килобаз и является самым большим среди РНК-вирусов.

Коронавирусы были обнаружены в 1960-х годах; самыми ранними из них были обнаружены вирус инфекционного бронхита у кур и два вируса из носовых полостей пациентов с простудой, которые впоследствии были названы человеческим коронавирусом 229E и человеческим коронавирусом OC43. С тех пор были идентифицированы другие члены этого семейства, в том числе SARS-CoV в 2003 году, HCoV NL63 в 2004 году, HKU1 в 2005 году, MERS-CoV в 2012 году и 2019-nCoV в 2019 году; большинство из них были связаны с серьезными инфекциями дыхательных путей [7].

Бета-коронавирусы, к которым относится BatCoV RaTG13, близкородственный к новому вирусу 2019-nCoV, являются одним из четырех родов коронавирусов. В более ранней литературе этот род также известен как коронавирусы 2-й группы.

Среди Бета-CoV наибольшее клиническое значение для людей имеют штаммы OC43 и HKU1 линии A, SARS-CoV и 2019-nCov линии B, и MERS-CoV линии C. MERS-CoV является первым бета-коронавирусом, принадлежащим к линии С, который поражает людей [8]. Альфа- и бета-коронавирусы происходят из генного пула летучих мышей [9, 10].

За последние два десятилетия коронавирусы вызвали две крупномасштабные пандемии: SARS и MERS (ближневосточный респираторный синдром) [11, 12].

SARS – коронавирус, вызвавший эпидемию тяжёлого острого респираторного синдрома (ТОРС, атипичная пневмония) в 2002 году, начавшуюся в Китае. В процессе размножения SARS разрушает клетки лёгочных альвеол, что может вести к смерти. Было подтверждено 8098–8422 случаев заражения, в результате чего в 17 странах зарегистрировано 774 летальных исходов (смертность 9,6–11 %) [13, 14].

Ближневосточный респираторный синдром (Middle East respiratory syndrome, MERS, MERS-CoV) вызывается бета-коронавирусом. Вспышка эпидемии наблюдалась преимущественно в странах Ближнего Востока в 2012 году; у большинства пациентов развивалось тяжелое острое респираторное заболевание, требующее госпитализации, и уровень смертности составлял 30–60 % [15]. Всего пострадало около 2000 человек. Сам вирус был выделен из летучей мыши [16]. MERS-CoV тесно связан с коронавирусами летучей мыши Tylonycteris HKU4 и Pipistrellus HKU5 – генетические последовательности идентичны более чем на 90 % [17].

По состоянию на март 2017 года ВОЗ сообщила о 1905 подтвержденных случаях MERS, включая 677 случаев смерти в 27 странах. MERS распространяется среди людей, вызывая серьезные осложнения, которые приводят к смерти; Отсюда вытекает необходимость разработки эффективных лечебно-профилактических средств. Было показано, что вспышка MERS в больнице произошла из-за передачи вируса от человека человеку [18]. В настоящее время не существует зарегистрированного лечения или вакцины против этой болезни, но инфекция MERS-CoV скорее управляется режимом медикаментозного лечения, в дополнение к некоторым профилактическим мерам для избегания повторного заражения [19]. Несколько исследований показали, что различные терапевтические средства могут ингибировать репликацию MERS-CoV в клеточной культуре.

В 2018 году был опубликован обширный обзор современных вариантов лечения ближневосточного респираторного синдрома (MERS) и роли пептидов как потенциальных терапевтических компонентов [20]. В этом обзоре кратко описаны важные лекарственные мишени MERS-CoV, представлены терапевтические варианты, доступные для лечения MERS, и описана их эффективность, а также обсуждается роль исследований пептидов в вирусологии и важность антимикробных пептидов (AMP) в качестве потенциальных терапевтических агентов по отношению к MERS. Предполагается, что быстрое развитие подходов вычислительной биологии может быть разработана новая и эффективная терапия MERS с использованием AMP.

  • Структурные и неструктурные белки MERS-CoV как лекарственные мишени

Путь передачи MERS-CoV от животных к человеку не был однозначно определен [21], но передача могла происходить от летучих мышей [16] через верблюдов, служащих промежуточными хозяевами [22]. Было показано, что MERS-CoV модулирует врожденный иммунный ответ, выработку антигена, митоген-активируемую протеинкиназу (MAPK) и апоптоз.

Структура MERS-CoV состоит из четырех структурных белков, включая белковый шиловидный отросток (S), белок оболочки (E), белок мембраны (M) и белок нуклеокапсида (N). Белок S представляет собой трансмембранный гликопротеин типа I, который находится на поверхности вирусной оболочки в состоянии тримера. Он состоит из субъединиц S1 и S2 и играет роль в проникновении вируса, связывании и слиянии. Субъединица S1 имеет рецептор-связывающий домен (RBD). RBD отвечает за связывание с клеточным рецептором дипептидилпептидазы 4 (DPP4). Субъединица S2 включает в себя две области, а именно гептадные повторы 1 и 2 (HR1 и HR2), которые собираются в комплекс, называемый ядро слияния, и представляет собой ключевую архитектуру мембранного синтеза [23]. Белок Е имеет общую длину 82 аминокислотных остатка и присутствует в основном во внутриклеточных мембранах вируса и играет основную роль в сборке вируса, почковании и внутриклеточном транспорте [24]. Белок М является компонентом вирусной оболочки, который играет роль в морфогенезе и сборке вируса посредством его взаимодействия с другими вирусными белками [25]. Белки S, M и E встраиваются в мембрану эндоплазматическиого ретикулума и транспортируются в область комплекса Гольджи, в которой они взаимодействуют с белками N с образованием частиц [26]. Это взаимодействие, в конечном итоге, будет мешать слиянию клеточных и вирусных мембран. Таким образом, перечисленные пептиды могут иметь большое значение в терапии с использованием пептидов. Кроме того, MERS-CoV состоит из двух больших полипротеинов, а именно pp1a и pp1ab, которые затем расщепляются на 16 неструктурных белков (nsps) [27]. Две протеазы, папаин-подобная протеаза (PLpro или nsp3) и 3C-подобная протеаза (3CLpro или nsp5), ответственны за обработку всех 16 nsps, которые необходимы для репликации и транскрипции. PLpro отвечает за расщепление в позиции 1-3 для развития трех nsps, тогда как 3CLpro расщепляет оставшиеся позиции 4-16. Эти nsps ответственны за вирусную РНК-зависимую активность РНК-полимеразы (nsp12), активность ДНК-праймазы (nsp8), активность РНК-геликазы (nsp13), активность экзорибонуклеазы (nsp14), активность эндорибонуклеазы (nsp15) и активность 2′-O-метилтрансферазы ( nsp16) [28]. Активность 2′-O-метилтрансферазы стимулируется nsp10, который действует как аллостерический активатор nsp16. Исследования показывают, что nsps коронавируса можно использовать в качестве мишеней для разработки новых методов лечения (см. ссылки в обзоре [20]). Как структурные, так и неструктурные белки могут выступать в качестве терапевтических мишеней, в которых могут быть реализованы различные терапевтические варианты, и они будут обсуждаться далее.

  • Роль пептидов как потенциальных противовирусных / противокоронавирусных агентов

Существует интерес к пептидным лекарственным средствам и их миметикам в качестве потенциальных антагонистов различных патогенов. Изучение пептидов является важным аспектом фармацевтических исследований, и в настоящее время в клинических испытаниях оценивается приблизительно 140 пептидных препаратов [29].

Причины использования пептидов заключаются в том, что (i) они ингибируют белок-белковые взаимодействия; (ii) их можно использовать в качестве альтернативной терапии заболеваний, на которые трудно воздействовать; (iii) существуют передовые методы для увеличения периода полужизни пептида и (iv) у них более короткое время выхода на рынок [30]. Пептидные лекарственные средства зачастую имеют незначительные побочные эффекты и хорошую переносимость по сравнению с химическими лекарственными средствами. Между тем, специфичность лечения высока. Пептидные препараты нуждаются в особых условиях хранения, в противном случае функция белка становится неактивной, что приводит к низкой пероральной биодоступности и склонности к быстрому метаболизму.

Многие пептидные ингибиторы проявляют активность против вирусов [31-33] и др. ссылки в обзоре [20]. Например, пептид RVFV-6, полученный из проксимального участка ствола мембраны гликопротеина Gc RVFV, предотвращает слияние вируса при лихорадки Рифт-Валли. Он также проявляет активность против неродственных вирусов, таких как EBOV и VSV. Производное пептида яда скорпиона Kn2-7 было идентифицировано как потенциальный агент против ВИЧ-1 с низкими цитотоксическими эффектами.

Отсутствие эффективного лечения способствовало разработке дополнительных терапевтических агентов с повышенной эффективностью для преодоления побочных эффектов, возникающих при современном лечении MERS. В последнее десятилетие наблюдается растущий интерес к области пептидной терапии из-за многочисленных побочных эффектов химических препаратов [34].

AMP являются превосходными кандидатами в качестве новых терапевтических агентов, поскольку, как сообщалось, они обладают анти-коронавирусной активностью [35]. AMP являются компонентами первой линии защиты иммунной системы, вырабатываемой как эукариотическими, так и прокариотическими видами. Это небольшие положительно заряженные пептиды, которые обладают избирательной токсичностью в отношении грамположительных и грамотрицательных бактерий, простейших, грибов и вирусов [36-39]. Их селективная токсичность обусловлена тем, что мембранный бислой микробов богат липополисахаридами и липотейхоевой кислотой, поэтому он заряжен отрицательно в отличие от положительного заряда AMP [38]. Противовирусные AMP имеют несколько способов действия, включая блокирование проникновения вируса при взаимодействии гепарансульфата, ингибирование проникновения вируса путем слияния со специфическими клеточными рецепторами и прекращение слияния вируса путем взаимодействия с гликопротеинами, мембраной и оболочкой вируса [40].

Ниже приведена таблица 1, в которой показаны (А) пептиды, ингибирующие слияние вируса; (B) пептиды, ингибирующие репликацию вируса; (C) пептиды, ингибирующие проникновение вируса. Подробное описание доступно по ссылкам, приведенным в таблице.

Часть данных в таблице 1 получена авторами [20] из база данных по антимикробным пептидам (APD, Antimicrobial Peptide Database – http://aps.unmc.edu/AP/), которая является оригинальной базой данных, работающей онлайн с 2003 года. В базе содержится и постоянно добавляется информация по пептидам, обнаруженным в разнообразных организмах. На сегодняшний день в ней содержится 3160 записей, в которые включено 139 защитных пептидов человека, 305 – млекопитающих, 1087 активных пептидов земноводных (1018 от лягушек), 134 пептида рыб, 45 пептидов рептилий, 42 – птиц, 559 – членистоногих, [310 – насекомых, 69 – ракообразных, 7 – многоножек , 171 – хелицерных, (43 от пауков, 88 от скорпионов)], 45 – моллюсков, 6 AMP от простейших и ряд синтетических пептидов. База позволяет выполнять поиск по названию организма, пептида, аминокислотной последовательности, по биологической активности и тд. Также предусмотрен модуль предсказания параметров пептида по аминокислотной последовательности и модуль дизайна антимикробных пептидов. Небезынтересен статистический раздел базы, суммирующий собранную информацию.

Таблица 1

Список анти-коронавирусных пептидов (* рассчитано с помощью APD3 – antimicrobial peptide calculator [41])

(A) Пептиды, ингибирующие слияние вируса
Пептид Аминокислотная последовательность Источник пептида Вирус *Результирующий заряд * Гидрофобные остатки (%) Токсичность (TC50) / индекс селективности (SI) IC50 Клеточная линия / животная модель Ссылки
SARSWW-III GYHLMSFPQAAPHGVVFLHVTW S2 субъединица SARS-CoV SARS-CoV 0 50 Нет разницы в абсорбции по сравнению с необработанными клетками ∼2 μM Vero E6 и L2 [42]
SARSWW-IV GVFVFNGTSWFITQRNFFS S2 субъединица SARS-CoV SARS-CoV 1 47 Нет разницы в абсорбции по сравнению с необработанными клетками ∼2 μM Vero E6 и L2 [42]
MHVWW-IV GYFVQDDGEWKFTGSSYYY S2 субъединица MHV MHV −2 21 Не цитотоксичен при концентрации
30 μM на L2
клетках
4 μM Vero E6 и L2 [42]
P1 LTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL HR2 область MERS-CoV MERS-CoV -3 42 ∼3.013 μM 293T [43]
HR2L SIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNY HR2 область MERS-CoV MERS-CoV -3 37 0.5 μM 293T/EGFP +Huh-7 [44]
HR2P SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL HR2 область MERS-CoV MERS-CoV -3 41 SI = CC50 /
IC50 > 1667
0.97±0.15 μM 293T/EGFP + Huh-7

[44]
HR2P-M1 SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKEL HR2 область MERS-CoV MERS-CoV -3 38 0.85±0.08 μM 293T/EGFP + Huh-7

[44]
HR2P-M2 SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL HR2 область MERS-CoV MERS-CoV -4 36 0.55±0.04 μM 293T/EGFP and Huh-7

[45]
P9 NGAICWGPCPTAFRQIGNCGHFKVRCCKIR Mouse β-defensin-4 SARS-CoV
MERS-CoV
5 46 Low toxicity
in vivo
5 μg/ml мыши [46]
(B) Пептиды, ингибирующие репликацию вируса
K29 FGGASCCLYCRCHIDHPNPKGFCDLKGKY nsp10 SARS-CoV SARS-CoV 2 37 160 μM E. coli [47]
K12  GGASCCLYCRCH nsp10 SARS-CoV SARS-CoV 1 50 160 μM E. coli [47]
HR2P SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL HR2 область MERS-CoV MERS-CoV -3 41 SI > 1667 ~0.6 μM Vero [44]
HR2P SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL HR2 область MERS-CoV MERS-CoV -3 41 SI > 1667 0.6 μM Calu-3 [44]
HR2P SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL HR2 область MERS-CoV MERS-CoV -3 41 13.9 μM HFL [44]
Mutant mucroporin-M1 LFRLIKSLIKRLVSAFK Mucropin AMP SARS-CoV 5 58 TC50 = 70.46 SI = 9.85 7.15 μg/ml MDCK [48]
(C) Пептиды, ингибирующие проникновение вируса (KD: константа диссоциации пептида)
H HVTTTFAPPPPR Porcine aminopeptidase N (pAPN) TGEV TGEV 1 25 0.55 (490 nm) 11 μg/ml ST [49]
S SVVPSKATWGFA Papn TGEV   1 50 0.5 (490 nm) 15 μg/ml ST [49]
RBD-11b  YKYRYL RBD SARS-CoV SARS-CoV 2 16 Нет доказательств токсичности KD = 46 μM  Vero E6 [50]
P8  PSSKRFQPFQQFGRDVSDFT S протеин SARS-CoV SARS-CoV 1 25 HEK293T [51]
P9 CANLLLQYGSFCTQLNRALSGIA S протеин SARS-CoV SARS-CoV 1 52 HEK293T [51]
  • Заключение

Существует острая необходимость в разработке наиболее эффективной терапии коронавирусов, таких как MERS, 2019-nCoV и новых, еще неизвестных, потенциально опасных агентов. Также необходима разработка протоколов для использования в рандомизированных контролируемых исследованиях. Исследования показали, что пептиды превратились в высокоэффективные агенты для передачи сигнала при вирусных заболеваниях. Предполагается, что противомикробные пептиды могут быть успешным терапевтическим вариантом для нового возбудителя MERS. Вычислительная биология в сочетании с вирусологией с большей эффективностью может ускорить наиболее продвинутый путь разработки пептидной терапии против MERS-CoV. Кроме того, предполагается, что переориентация существующих и клинически одобренных анти-коронавирусных и антивирусных пептидных препаратов может быть использована в качестве многообещающего направления для разработки новых агентов против MERS-CoV и подобных коронавирусов.

Дополинтельно:

1.         Откуда берутся коронавирусы и почему они так опасны? BBC Russian Service. 2020  [Access Date: 2020-01-27]; Available from: https://www.bbc.com/russian/features-51239831.

2.         Wuhan Coronavirus (2019-nCoV) Global Cases. JHU CSSE. 2020  [Access Date: 2020-01-28]; Available from: https://gisanddata.maps.arcgis.com/apps/opsdashboard/index.html#/bda7594740fd40299423467b48e9ecf6.

3.         Davies, W., Tan, S. The Age, Sex and Symptoms of China’s Coronavirus Victims. Bloomberg. 2020  [Access Date: 2020-01-27]; Available from: https://www.bloomberg.com/news/articles/2020-01-23/several-china-coronavirus-victims-didn-t-even-have-a-fever.

4.         2019 Novel Coronavirus (2019 nCoV): Frequently Asked Questions. Illinois Department of Public Health. 2020  [Access Date: 2020-01-27]; Available from: http://www.dph.illinois.gov/topics-services/diseases-and-conditions/diseases-a-z-list/coronavirus/faq.

5.         ASM985889v3 Wuhan seafood market pneumonia virus (viruses). The National Center for Biotechnology Information. 2020  [Access Date: 2020-01-27]; Available from: https://www.ncbi.nlm.nih.gov/assembly/GCF_009858895.2.

6.         Zhou, P., Yang, X.-L., Wang, X.-G., Hu, B., Zhang, L., Zhang, W., Si, H.-R., Zhu, Y., Li, B., Huang, C.-L., Chen, H.-D., Chen, J., Luo, Y., Guo, H., Jiang, R.-D., Liu, M.-Q., Chen, Y., Shen, X.-R., Wang, X., Zheng, X.-S., Zhao, K., Chen, Q.-J., Deng, F., Liu, L.-L., Yan, B., Zhan, F.-X., Wang, Y.-Y., Xiao, G., Shi, Z.-L., Discovery of a novel coronavirus associated with the recent pneumonia outbreak in humans and its potential bat origin. bioRxiv, 2020: p. 2020.2001.2022.914952. DOI: 10.1101/2020.01.22.914952.

7.         Coronavirus. Wikipedia, the free encyclopedia. 2020  [Access Date: 2020-01-28]; Available from: https://en.wikipedia.org/wiki/Coronavirus#History.

8.         Memish, Z.A., Zumla, A.I., Al-Hakeem, R.F., Al-Rabeeah, A.A., Stephens, G.M., Family Cluster of Middle East Respiratory Syndrome Coronavirus Infections. New England Journal of Medicine, 2013. 368(26): p. 2487-2494. DOI: 10.1056/NEJMoa1303729.

9.         Lau, S.K.P., Poon, R.W.S., Wong, B.H.L., Wang, M., Huang, Y., Xu, H., Guo, R., Li, K.S.M., Gao, K., Chan, K.-H., Zheng, B.-J., Woo, P.C.Y., Yuen, K.-Y., Coexistence of Different Genotypes in the Same Bat and Serological Characterization of <em>Rousettus</em> Bat Coronavirus HKU9 Belonging to a Novel <em>Betacoronavirus</em> Subgroup. Journal of Virology, 2010. 84(21): p. 11385. DOI: 10.1128/JVI.01121-10.

10.       Woo, P.C.Y., Wang, M., Lau, S.K.P., Xu, H., Poon, R.W.S., Guo, R., Wong, B.H.L., Gao, K., Tsoi, H.-w., Huang, Y., Li, K.S.M., Lam, C.S.F., Chan, K.-h., Zheng, B.-j., Yuen, K.-y., Comparative Analysis of Twelve Genomes of Three Novel Group 2c and Group 2d Coronaviruses Reveals Unique Group and Subgroup Features. Journal of Virology, 2007. 81(4): p. 1574. DOI: 10.1128/JVI.02182-06.

11.       Drosten, C., Günther, S., Preiser, W., van der Werf, S., Brodt, H.-R., Becker, S., Rabenau, H., Panning, M., Kolesnikova, L., Fouchier, R.A.M., Berger, A., Burguière, A.-M., Cinatl, J., Eickmann, M., Escriou, N., Grywna, K., Kramme, S., Manuguerra, J.-C., Müller, S., Rickerts, V., Stürmer, M., Vieth, S., Klenk, H.-D., Osterhaus, A.D.M.E., Schmitz, H., Doerr, H.W., Identification of a Novel Coronavirus in Patients with Severe Acute Respiratory Syndrome. New England Journal of Medicine, 2003. 348(20): p. 1967-1976. DOI: 10.1056/NEJMoa030747.

12.       Zaki, A.M., van Boheemen, S., Bestebroer, T.M., Osterhaus, A.D.M.E., Fouchier, R.A.M., Isolation of a Novel Coronavirus from a Man with Pneumonia in Saudi Arabia. New England Journal of Medicine, 2012. 367(19): p. 1814-1820. DOI: 10.1056/NEJMoa1211721.

13.       Smith, R.D., Responding to global infectious disease outbreaks: Lessons from SARS on the role of risk perception, communication and management. Social Science & Medicine, 2006. 63(12): p. 3113-3123. DOI:  10.1016/j.socscimed.2006.08.004.

14.       Chan-Yeung, M., Xu, R.-H., SARS: epidemiology. Respirology, 2003. 8(s1): p. S9-S14. DOI: 10.1046/j.1440-1843.2003.00518.x.

15.       de Groot, R.J., Baker, S.C., Baric, R.S., Brown, C.S., Drosten, C., Enjuanes, L., Fouchier, R.A.M., Galiano, M., Gorbalenya, A.E., Memish, Z.A., Perlman, S., Poon, L.L.M., Snijder, E.J., Stephens, G.M., Woo, P.C.Y., Zaki, A.M., Zambon, M., Ziebuhr, J., Commentary: Middle East Respiratory Syndrome Coronavirus (MERS-CoV): Announcement of the Coronavirus Study Group. Journal of Virology, 2013. 87(14): p. 7790. DOI: 10.1128/JVI.01244-13.

16.       Ziad, A.M., Nischay, M., Kevin, J.O., Shamsudeen, F.F., Vishal, K., Jonathan, H.E., Rafat, A., Abdulkareem, D., Mushabab Al, A., Ariful, I., Amit, K., Thomas, B., Peter, D., Abdullah, A.A.R., Lipkin, W.I., Middle East Respiratory Syndrome Coronavirus in Bats, Saudi Arabia. Emerging Infectious Disease journal, 2013. 19(11): p. 1819. DOI: 10.3201/eid1911.131172.

17.       Wang, Q., Qi, J., Yuan, Y., Xuan, Y., Han, P., Wan, Y., Ji, W., Li, Y., Wu, Y., Wang, J., Iwamoto, A., Woo, Patrick C.Y., Yuen, K.-Y., Yan, J., Lu, G., Gao, George F., Bat Origins of MERS-CoV Supported by Bat Coronavirus HKU4 Usage of Human Receptor CD26. Cell Host & Microbe, 2014. 16(3): p. 328-337. DOI: 10.1016/j.chom.2014.08.009.

18.       Assiri, A., McGeer, A., Perl, T.M., Price, C.S., Al Rabeeah, A.A., Cummings, D.A.T., Alabdullatif, Z.N., Assad, M., Almulhim, A., Makhdoom, H., Madani, H., Alhakeem, R., Al-Tawfiq, J.A., Cotten, M., Watson, S.J., Kellam, P., Zumla, A.I., Memish, Z.A., Team, K.M.-C.I., Hospital outbreak of Middle East respiratory syndrome coronavirus. N Engl J Med, 2013. 369(5): p. 407-416. DOI: 10.1056/NEJMoa1306742.

19.       Liu, Q., Xia, S., Sun, Z., Wang, Q., Du, L., Lu, L., Jiang, S., Testing of Middle East Respiratory Syndrome Coronavirus Replication Inhibitors for the Ability To Block Viral Entry. Antimicrobial Agents and Chemotherapy, 2015. 59(1): p. 742. DOI: 10.1128/AAC.03977-14.

20.       Mustafa, S., Balkhy, H., Gabere, M.N., Current treatment options and the role of peptides as potential therapeutic components for Middle East Respiratory Syndrome (MERS): A review. Journal of Infection and Public Health, 2018. 11(1): p. 9-17. DOI:  10.1016/j.jiph.2017.08.009.

21.       Chowell, G., Blumberg, S., Simonsen, L., Miller, M.A., Viboud, C., Synthesizing data and models for the spread of MERS-CoV, 2013: Key role of index cases and hospital transmission. Epidemics, 2014. 9: p. 40-51. DOI:  10.1016/j.epidem.2014.09.011.

22.       Ge, X.-Y., Li, J.-L., Yang, X.-L., Chmura, A.A., Zhu, G., Epstein, J.H., Mazet, J.K., Hu, B., Zhang, W., Peng, C., Zhang, Y.-J., Luo, C.-M., Tan, B., Wang, N., Zhu, Y., Crameri, G., Zhang, S.-Y., Wang, L.-F., Daszak, P., Shi, Z.-L., Isolation and characterization of a bat SARS-like coronavirus that uses the ACE2 receptor. Nature, 2013. 503(7477): p. 535-538. DOI: 10.1038/nature12711.

23.       Zumla, A., Hui, D.S., Perlman, S., Middle East respiratory syndrome. The Lancet, 2015. 386(9997): p. 995-1007. DOI:  10.1016/S0140-6736(15)60454-8.

24.       Surya, W., Li, Y., Verdià-Bàguena, C., Aguilella, V.M., Torres, J., MERS coronavirus envelope protein has a single transmembrane domain that forms pentameric ion channels. Virus Research, 2015. 201: p. 61-66. DOI:  10.1016/j.virusres.2015.02.023.

25.       Liu, J., Sun, Y., Qi, J., Chu, F., Wu, H., Gao, F., Li, T., Yan, J., Gao, G.F., The Membrane Protein of Severe Acute Respiratory Syndrome Coronavirus Acts as a Dominant Immunogen Revealed by a Clustering Region of Novel Functionally and Structurally Defined Cytotoxic T-Lymphocyte Epitopes. The Journal of Infectious Diseases, 2010. 202(8): p. 1171-1180. DOI: 10.1086/656315.

26.       de Haan, C.A.M., Rottier, P.J.M., Molecular Interactions in the Assembly of Coronaviruses, in Advances in Virus Research. 2005, Academic Press. p. 165-230.

27.       Cho, C.-C., Lin, M.-H., Chuang, C.-Y., Hsu, C.-H., Macro Domain from Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Is an Efficient ADP-ribose Binding Module: CRYSTAL STRUCTURE AND BIOCHEMICAL STUDIES. Journal of Biological Chemistry, 2016. 291(10): p. 4894-4902.

28.       Durai, P., Batool, M., Shah, M., Choi, S., Middle East respiratory syndrome coronavirus: transmission, virology and therapeutic targeting to aid in outbreak control. Experimental & Molecular Medicine, 2015. 47(8): p. e181-e181. DOI: 10.1038/emm.2015.76.

29.       Fosgerau, K., Hoffmann, T., Peptide therapeutics: current status and future directions. Drug Discovery Today, 2015. 20(1): p. 122-128. DOI:  10.1016/j.drudis.2014.10.003.

30.       Kaspar, A.A., Reichert, J.M., Future directions for peptide therapeutics development. Drug Discovery Today, 2013. 18(17): p. 807-817. DOI:  10.1016/j.drudis.2013.05.011.

31.       Ali, M.M., Karasneh, G.A., Jarding, M.J., Tiwari, V., Shukla, D., A 3-<em>O</em>-Sulfated Heparan Sulfate Binding Peptide Preferentially Targets Herpes Simplex Virus 2-Infected Cells. Journal of Virology, 2012. 86(12): p. 6434. DOI: 10.1128/JVI.00433-12.

32.       Tincho, M.B., Gabere, M.N., Pretorius, A., In silico identification and molecular validation of putative antimicrobial peptides for HIV therapy. Journal of AIDS Clinical Research, 2016. 7(9).

33.       Melnik, L.I., Garry, R.F., Morris, C.A., Peptide inhibition of human cytomegalovirus infection. Virology Journal, 2011. 8(1): p. 76. DOI: 10.1186/1743-422X-8-76.

34.       Albericio, F., Kruger, H.G., Therapeutic peptides. Future Medicinal Chemistry, 2012. 4(12): p. 1527-1531. DOI: 10.4155/fmc.12.94.

35.       Qureshi, A., Thakur, N., Tandon, H., Kumar, M., AVPdb: a database of experimentally validated antiviral peptides targeting medically important viruses. Nucleic Acids Research, 2013. 42(D1): p. D1147-D1153. DOI: 10.1093/nar/gkt1191.

36.       Fjell, C.D., Hancock, R.E.W., Cherkasov, A., AMPer: a database and an automated discovery tool for antimicrobial peptides. Bioinformatics, 2007. 23(9): p. 1148-1155. DOI: 10.1093/bioinformatics/btm068.

37.       Fjell, C.D., Hiss, J.A., Hancock, R.E.W., Schneider, G., Designing antimicrobial peptides: form follows function. Nature Reviews Drug Discovery, 2012. 11(1): p. 37-51. DOI: 10.1038/nrd3591.

38.       Ganz, T., Defensins: antimicrobial peptides of innate immunity. Nature Reviews Immunology, 2003. 3(9): p. 710-720. DOI: 10.1038/nri1180.

39.       Wang, Z., Wang, G., APD: the Antimicrobial Peptide Database. Nucleic Acids Research, 2004. 32(suppl_1): p. D590-D592. DOI: 10.1093/nar/gkh025.

40.       Jenssen, H., Hamill, P., Hancock, R.E.W., Peptide Antimicrobial Agents. Clinical Microbiology Reviews, 2006. 19(3): p. 491. DOI: 10.1128/CMR.00056-05.

41.       Wang, G., Li, X., Wang, Z., APD3: the antimicrobial peptide database as a tool for research and education. Nucleic Acids Research, 2015. 44(D1): p. D1087-D1093. DOI: 10.1093/nar/gkv1278.

42.       Sainz, B., Mossel, E.C., Gallaher, W.R., Wimley, W.C., Peters, C.J., Wilson, R.B., Garry, R.F., Inhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein. Virus Research, 2006. 120(1): p. 146-155. DOI:  10.1016/j.virusres.2006.03.001.

43.       Gao, J., Lu, G., Qi, J., Li, Y., Wu, Y., Deng, Y., Geng, H., Li, H., Wang, Q., Xiao, H., Tan, W., Yan, J., Gao, G.F., Structure of the Fusion Core and Inhibition of Fusion by a Heptad Repeat Peptide Derived from the S Protein of Middle East Respiratory Syndrome Coronavirus. Journal of Virology, 2013. 87(24): p. 13134. DOI: 10.1128/JVI.02433-13.

44.       Lu, L., Liu, Q., Zhu, Y., Chan, K.H., Qin, L., Li, Y., Wang, Q., Chan, J.F., Du, L., Yu, F., Ma, C., Ye, S., Yuen, K.Y., Zhang, R., Jiang, S., Structure-based discovery of Middle East respiratory syndrome coronavirus fusion inhibitor. Nature communications, 2014. 5: p. 3067. DOI: 10.1038/ncomms4067.

45.       Channappanavar, R., Lu, L., Xia, S., Du, L., Meyerholz, D.K., Perlman, S., Jiang, S., Protective Effect of Intranasal Regimens Containing Peptidic Middle East Respiratory Syndrome Coronavirus Fusion Inhibitor Against MERS-CoV Infection. The Journal of Infectious Diseases, 2015. 212(12): p. 1894-1903. DOI: 10.1093/infdis/jiv325.

46.       Zhao, H., Zhou, J., Zhang, K., Chu, H., Liu, D., Poon, V.K.-M., Chan, C.C.-S., Leung, H.-C., Fai, N., Lin, Y.-P., Zhang, A.J.-X., Jin, D.-Y., Yuen, K.-Y., Zheng, B.-J., A novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses. Scientific reports, 2016. 6: p. 22008-22008. DOI: 10.1038/srep22008.

47.       Ke, M., Chen, Y., Wu, A., Sun, Y., Su, C., Wu, H., Jin, X., Tao, J., Wang, Y., Ma, X., Pan, J.-A., Guo, D., Short peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2′-O-methyltransferase activity of nsp10/nsp16 complex. Virus Research, 2012. 167(2): p. 322-328. DOI:  10.1016/j.virusres.2012.05.017.

48.       Li, Q., Zhao, Z., Zhou, D., Chen, Y., Hong, W., Cao, L., Yang, J., Zhang, Y., Shi, W., Cao, Z., Wu, Y., Yan, H., Li, W., Virucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses. Peptides, 2011. 32(7): p. 1518-1525. DOI:  10.1016/j.peptides.2011.05.015.

49.       Ren, X., Liu, B., Yin, J., Zhang, H., Li, G., Phage displayed peptides recognizing porcine aminopeptidase N inhibit transmissible gastroenteritis coronavirus infection in vitro. Virology, 2011. 410(2): p. 299-306. DOI:  10.1016/j.virol.2010.11.014.

50.       Struck, A.-W., Axmann, M., Pfefferle, S., Drosten, C., Meyer, B., A hexapeptide of the receptor-binding domain of SARS corona virus spike protein blocks viral entry into host cells via the human receptor ACE2. Antiviral Research, 2012. 94(3): p. 288-296. DOI:  10.1016/j.antiviral.2011.12.012.

51.       Lu, W., Wu, X.-D., Shi, M.D., Yang, R.F., He, Y.Y., Bian, C., Shi, T.L., Yang, S., Zhu, X.-L., Jiang, W.-H., Li, Y.X., Yan, L.-C., Ji, Y.Y., Lin, Y., Lin, G.-M., Tian, L., Wang, J., Wang, H.X., Xie, Y.H., Pei, G., Wu, J.R., Sun, B., Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential. FEBS Letters, 2005. 579(10): p. 2130-2136. DOI:  10.1016/j.febslet.2005.02.070.